BACH2 Antibody

Images

 
Western Blot: BACH2 Antibody [NBP2-14345] - Analysis in human cell line Daudi.
Immunohistochemistry-Paraffin: BACH2 Antibody [NBP2-14345] - Staining of human tonsil shows strong nuclear positivity in in germinal and non-germinal center cells.
Immunohistochemistry-Paraffin: BACH2 Antibody [NBP2-14345] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BACH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEPDVPTDTKE SSEKDALTQYPRYKKYQLACTKNVYNASSHSTSGFASTFREDNSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BACH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BACH2 Recombinant Protein Antigen (NBP2-14345PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BACH2 Antibody

  • BTB and CNC homolog 2
  • BTB and CNC homology 1, basic leucine zipper transcription factor 2
  • transcription regulator protein BACH2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP2-01904
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF3487
Species: Hu
Applications: WB, IHC, ICC
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF5525
Species: Hu
Applications: WB, IHC
MAB3809
Species: Hu, Mu
Applications: WB
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BACH2 Antibody (NBP2-14345) (0)

There are no publications for BACH2 Antibody (NBP2-14345).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BACH2 Antibody (NBP2-14345) (0)

There are no reviews for BACH2 Antibody (NBP2-14345). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BACH2 Antibody (NBP2-14345) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BACH2 Products

Bioinformatics Tool for BACH2 Antibody (NBP2-14345)

Discover related pathways, diseases and genes to BACH2 Antibody (NBP2-14345). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BACH2 Antibody (NBP2-14345)

Discover more about diseases related to BACH2 Antibody (NBP2-14345).
 

Pathways for BACH2 Antibody (NBP2-14345)

View related products by pathway.

PTMs for BACH2 Antibody (NBP2-14345)

Learn more about PTMs related to BACH2 Antibody (NBP2-14345).

Blogs on BACH2

There are no specific blogs for BACH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BACH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BACH2