ORMDL3 Antibody

Western Blot: ORMDL3 Antibody [NBP1-98511] - Host: Rabbit. Target: ORMDL3. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): THP1 Cell Lysate (N30). Antibody concentration: 4ug/ml

Western Blot: ORMDL3 Antibody [NBP1-98511] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%

Western Blot: ORMDL3 Antibody [NBP1-98511] - Host: Rabbit. Target Name: ORMDL3. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ORMDL3 Antibody Summary

• Immunogen: The immunogen for this antibody is ORMDL3 - N-terminal region. Peptide sequence GTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ORMDL3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ORMDL3 Antibody

• ORM1 (S. cerevisiae)-like 3
• ORM1-like 3 (S. cerevisiae)
• ORM1-like protein 3

Background

ORMDL3 is a negative regulator of sphingolipid synthesis. ORMDL3 may indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ORMDL3 Antibody (NBP1-98511)(2)

Publications using NBP1-98511

• Nagaraj M, HOring M, Ahonen MA et al. GOLM1 depletion modifies cellular sphingolipid metabolism and adversely affects cell growth Journal of lipid research 2022-08-07 [PMID: 35948172] (WB, Human)
• Davis DL, Mahawar U, Pope VS, Allegood J Dynamics of sphingolipids and the serine-palmitoyltransferase complex in oligodendrocytes during myelination. J Lipid Res 2020-02-12 [PMID: 32041816]

FAQs for ORMDL3 Antibody (NBP1-98511). (Showing 1 - 1 of 1 FAQs).

1. I was wondering if you had any data showing if your anti-ORMDL3 antibody (NBP1-98511) is selective for ORMDL3 over ORMDL1 and ORMDL2? Also, is the Jurkat lysate shown detecting endogenous levels of ORMDL3 by Western?
   • The Western blot image you see on our datasheet is of Jurkat cell lysate and corresponds to endogenous levels of ORMDL3, not an overexpression lysate. The antibody is predicted to react with ORMDL1, ORMDL2 and ORMDL3.

Bioinformatics

• Gene Symbol: ORMDL3
• Uniprot:
  • NP_644809(Human)