ORMDL3 Antibody

Images

 
Western Blot: ORMDL3 Antibody [NBP1-98511] - Host: Rabbit. Target: ORMDL3. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): THP1 Cell Lysate (N30). Antibody concentration: 4ug/ml
Western Blot: ORMDL3 Antibody [NBP1-98511] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%
Western Blot: ORMDL3 Antibody [NBP1-98511] - Host: Rabbit. Target Name: ORMDL3. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gt, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ORMDL3 Antibody Summary

Immunogen
The immunogen for this antibody is ORMDL3 - N-terminal region. Peptide sequence GTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTN. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Goat (100%), Equine (100%), Zebrafish (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORMDL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-98511 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ORMDL3 Antibody

  • ORM1 (S. cerevisiae)-like 3
  • ORM1-like 3 (S. cerevisiae)
  • ORM1-like protein 3

Background

ORMDL3 is a negative regulator of sphingolipid synthesis. ORMDL3 may indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33648
Species: Hu
Applications: IHC, IHC-P
NBP1-82689
Species: Hu
Applications: WB, IHC, IHC-P
AF523
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, Neut
NBP2-24495
Species: Hu, Pm
Applications: WB, ICC/IF
NBP1-77681
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA
NBP1-87528
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB840
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC, Neut
NBP1-89558
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB5565
Species: Hu
Applications: IP, CyTOF-ready, ICFlow
NBP1-76377
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-56479
Species: Hu, Mu, Rt, Po, Bv, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ORMDL3 Antibody (NBP1-98511)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-98511 Applications Species
Davis DL, Mahawar U, Pope VS, Allegood J Dynamics of sphingolipids and the serine-palmitoyltransferase complex in oligodendrocytes during myelination. bioRxiv Jan 1 2020 (WB, Rat) WB Rat

Reviews for ORMDL3 Antibody (NBP1-98511) (0)

There are no reviews for ORMDL3 Antibody (NBP1-98511). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ORMDL3 Antibody (NBP1-98511). (Showing 1 - 1 of 1 FAQ).

  1. I was wondering if you had any data showing if your anti-ORMDL3 antibody (NBP1-98511) is selective for ORMDL3 over ORMDL1 and ORMDL2? Also, is the Jurkat lysate shown detecting endogenous levels of ORMDL3 by Western?
    • The Western blot image you see on our datasheet is of Jurkat cell lysate and corresponds to endogenous levels of ORMDL3, not an overexpression lysate. The antibody is predicted to react with ORMDL1, ORMDL2 and ORMDL3.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ORMDL3 Products

Bioinformatics Tool for ORMDL3 Antibody (NBP1-98511)

Discover related pathways, diseases and genes to ORMDL3 Antibody (NBP1-98511). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORMDL3 Antibody (NBP1-98511)

Discover more about diseases related to ORMDL3 Antibody (NBP1-98511).
 

Pathways for ORMDL3 Antibody (NBP1-98511)

View related products by pathway.

PTMs for ORMDL3 Antibody (NBP1-98511)

Learn more about PTMs related to ORMDL3 Antibody (NBP1-98511).

Blogs on ORMDL3

There are no specific blogs for ORMDL3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ORMDL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ORMDL3
Uniprot