Reactivity | Hu, Mu, Rt, Bv, Ca, Eq, Gt, Gp, Rb, ZeSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | The immunogen for this antibody is ORMDL3 - N-terminal region. Peptide sequence GTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTN. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Mouse (100%), Rat (100%), Canine (100%), Goat (100%), Equine (100%), Zebrafish (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ORMDL3 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Theoretical MW | 17 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-98511 | Applications | Species |
---|---|---|
Davis DL, Mahawar U, Pope VS, Allegood J Dynamics of sphingolipids and the serine-palmitoyltransferase complex in oligodendrocytes during myelination. bioRxiv Jan 1 2020 (WB, Rat) | WB | Rat |
Secondary Antibodies |
Isotype Controls |
Diseases for ORMDL3 Antibody (NBP1-98511)Discover more about diseases related to ORMDL3 Antibody (NBP1-98511).
| Pathways for ORMDL3 Antibody (NBP1-98511)View related products by pathway.
|
PTMs for ORMDL3 Antibody (NBP1-98511)Learn more about PTMs related to ORMDL3 Antibody (NBP1-98511).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.