Home » ORMDL3 » ORMDL3 Antibodies » ORMDL3 Antibody

ORMDL3 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ORMDL3 Antibody [NBP1-98511] - Host: Rabbit. Target: ORMDL3. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): THP1 Cell Lysate (N30). Antibody concentration: 4ug/ml
Western Blot: ORMDL3 Antibody [NBP1-98511] - Host: Rabbit. Target: ORMDL3. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): THP1 Cell Lysate (N30). Antibody concentration: 4ug/ml
Western Blot: ORMDL3 Antibody [NBP1-98511] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%
Western Blot: ORMDL3 Antibody [NBP1-98511] - Host: Rabbit. Target Name: ORMDL3. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gt, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ORMDL3 Antibody Summary

Immunogen
The immunogen for this antibody is ORMDL3 - N-terminal region. Peptide sequence GTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTN. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Goat (100%), Equine (100%), Zebrafish (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORMDL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-98511 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ORMDL3 Antibody

  • ORM1 (S. cerevisiae)-like 3
  • ORM1-like 3 (S. cerevisiae)
  • ORM1-like protein 3

Background

ORMDL3 is a negative regulator of sphingolipid synthesis. ORMDL3 may indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Gasdermin like
Antibody
NBP2-33648
Immunohistochemistry-Paraffin: Gasdermin like Antibody [NBP2-33648] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Gasdermin like Antibody [NBP2-33648] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Gasdermin like Antibody [NBP2-33648] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
ZPBP2 Antibody
NBP1-82689
Western Blot: ZPBP2 Antibody [NBP1-82689] - Analysis in control (vector only transfected HEK293T lysate) and ZPBP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human lymph node.
Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human endometrium shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
IL-13 [HRP]
M1300CB
(3 Reviews)
(113 Publications)
Species: Mu
ST2/IL-33R
Antibody [Unconjugate
AF523
Recombinant Human IL‑33 induces IFN-gamma secretion in Human Peripheral Blood Mononuclear cells (PBMC) in the presence of 0.25 ng/mL Recombinant Human IL-12 (Catalog # 219-IL)  in a dose-dependent manner (orange line), as measured by the Human IFN-gamma Q-kit (Catalog # DIF50). Under these conditions, IFN-gamma secretion elicited by IL‑33 is neutralized (green line) by increasing concentrations of Goat Anti-Human ST2/IL-33 R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF523). The ND50 is typically 0.1-0.6 μg/mL.
Simple Western lane view shows lysates of human kidney tissue and human lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ST2/IL-33 R at approximately 60 kDa (as indicated) using 2 µg/mL of Goat Anti-Human ST2/IL-33 R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF523) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
KG‑1a human acute myelogenous leukemia cell line was stained with Goat Anti-Human ST2/IL-33 R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF523, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
(1 Review)
(11 Publications)
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, Neut
IL-33
[Unconjugated]
3626-ML/CF
IL-33 [Unconjugated]
(79 Publications)
Species: Mu
Aiolos/IKZF3
Antibody
NBP2-24495
Western Blot: Aiolos/IKZF3 Antibody [NBP2-24495] - Total protein from Jurkat cells and human tonsil was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-IkZF3 in blocking buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Aiolos/IKZF3 Antibody [NBP2-24495] - IKZF3 antibody was tested in Jurkat cells at a 1:40 dilution against DyLight 488 (Green). Alpha tubulin and nuclei were counterstained against DyLight 568 (Red) and DAPI (Blue), respectively.
Western Blot: Aiolos/IKZF3 Antibody [NBP2-24495] - Analysis of IKZF3 in human spleen lysate in the 1) absence and 2) presence of immunizing peptide using this antibody at 0.25 ug/mL.
(9 Publications)
Species: Hu, Pm
Applications: WB, ICC/IF
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
XBP1 Antibody
NBP1-77681
Western Blot: XBP1 Antibody [NBP1-77681] - Total protein from HeLa cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-XBP1 in block buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence. Arrow delineates XBP1s and arrowhead XBP1u.
Immunocytochemistry/Immunofluorescence: XBP1 Antibody [NBP1-77681] - XBP1 antibody was tested in HeLa cells with FITC (green). Nuclei and actin were counterstained with Dapi (blue) and Phalloidin (red).
Immunohistochemistry: XBP1 Antibody [NBP1-77681] - Staining of XBP1 in mouse bladder using DAB with hematoxylin counterstain.
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
IL-4 [Unconjugated]
6507-IL/CF
IL-4 [Unconjugated]
(3 Publications)
Species: Hu
alpha 1-Acid
Glycoprotein [HRP]
DAGP00
(4 Publications)
Species: Hu
IL-2 R beta
Antibody (27302)
MAB224
IL‑2 R beta was detected in immersion fixed frozen sections of human lymph node using 15 µg/mL Mouse Anti-Human IL‑2 R beta Monoclonal Antibody (Catalog # MAB224) overnight at 4 °C. Tissue was stained (red) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Recombinant Human IL‑2 (Catalog # 202-IL) stimulates proliferation in the MO7e human megakaryocytic leukemic cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human IL‑2 (30 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL‑2 R beta Monoclonal Antibody (Catalog # MAB224). The ND50 is typically 0.05‑0.15 µg/mL.
(5 Publications)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Phosphodiesterase
4D Antibody
NB100-2462
Western Blot: Phosphodiesterase 4D Antibody [NB100-2462] - HEK293 overexpressing Human PDE4D2 and probed with (mock transfection in first lane).
Immunohistochemistry-Paraffin: Phosphodiesterase 4D Antibody [NB100-2462] - staining of paraffin embedded Human Skeletal Muscle. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: Phosphodiesterase 4D Antibody [NB100-2462] - (1ug/ml) of COS cell lysates (25ug protein): transfected with Human PDE4D1 (1), transfected with Human PDE4D3 (2), untransfected (3). Primary incubation was 1 hour. Detected by chemiluminescence.
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA
Filaggrin Antibody
NBP1-87528
Immunocytochemistry/Immunofluorescence: Filaggrin Antibody [NBP1-87528] - Staining of human cell line HaCaT shows localization to vesicles.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human kidney shows low expression as expected.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
IL-18R alpha/IL-1
R5 Antibody (70625) [ ...
MAB840
IL‑18 R alpha /IL‑1 R5 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using 10 µg/mL Mouse Anti-Human IL‑18 R alpha /IL‑1 R5 Mono­clonal Antibody (Catalog # MAB840) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
In the presence of Recombinant Human TNF‑ alpha (20 ng/mL, Catalog # 210-TA), Recombinant Human IL‑18/IL‑1F4 (Catalog # B003-5) stimulates IFN‑ gamma secretion in KG-1 human myeloid leukemia cells in a dose-dependent manner (orange line), as measured by the Human IFN‑ gamma Quantikine ELISA Kit (Catalog # DIF50). Under these conditions, IFN‑ gamma secretion elicited by Recombinant Human IL‑18/IL‑1F4 (40 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL‑18 R alpha /IL‑1 R5 Monoclonal Antibody (Catalog # MAB840). The ND50 is typically 0.03‑0.1 µg/mL.
(9 Publications)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC, Neut
SELS Antibody
NBP1-89558
Western Blot: SELS Antibody [NBP1-89558] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SELENOS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: SELS Antibody [NBP1-89558] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: SELS Antibody [NBP1-89558] - Staining of human tonsil shows strong cytoplasmic positivity in a small subset of germinal center cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
ADAM33 Antibody
(508101)
MAB5565
A549 human lung carcinoma cell line was stained with Mouse Anti-Human ADAM33 Monoclonal Antibody (Catalog # MAB5565, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: IP, CyTOF-ready, ICFlow
IRGM Antibody
NBP1-76377
Western Blot: IRGM Antibody [NBP1-76377] - Analysis of IRGM expression in SK-N-SH cell lysate with IRGM antibody at (A) 1 and (B) 2 ug/ml.
Immunohistochemistry-Paraffin: IRGM Antibody [NBP1-76377] - Staining of CD4 in human thymus tissue with CD4 antibody at 5 ug/ml.
Immunofluorescence: IRGM Antibody [NBP1-76377] - Staining of IRGM in Human Brain tissue with IRGM antibody at 20 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
IL-18/IL-1F4 [HRP]
7620
IL-18/IL-1F4 [HRP]
(39 Publications)
Species: Hu
Smad3 Antibody
NB100-56479
Western Blot: Smad3 Antibody [NB100-56479] - Analysis in human fibroblast and HeLa whole cell lysates. Untreated lysates show a band around 55 Kda. 1:1000 dilution, 1 hour blocking in milk 5%. Image from a verified customer review.
Immunocytochemistry/Immunofluorescence: Smad3 Antibody [NB100-56479] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-Smad3 at 10 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Smad3 Antibody [NB100-56479] - Human liver tissue probed with SMAD3 antibody (bottom left, right) and isotype control antibody (top left) at 10 ug/ml.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ORMDL3 Antibody (NBP1-98511)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-98511 Applications Species
Davis DL, Mahawar U, Pope VS, Allegood J Dynamics of sphingolipids and the serine-palmitoyltransferase complex in oligodendrocytes during myelination. bioRxiv Jan 1 2020 (WB, Rat) WB Rat

Reviews for ORMDL3 Antibody (NBP1-98511) (0)

There are no reviews for ORMDL3 Antibody (NBP1-98511). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ORMDL3 Antibody (NBP1-98511). (Showing 1 - 1 of 1 FAQ).

  1. I was wondering if you had any data showing if your anti-ORMDL3 antibody (NBP1-98511) is selective for ORMDL3 over ORMDL1 and ORMDL2? Also, is the Jurkat lysate shown detecting endogenous levels of ORMDL3 by Western?
    • The Western blot image you see on our datasheet is of Jurkat cell lysate and corresponds to endogenous levels of ORMDL3, not an overexpression lysate. The antibody is predicted to react with ORMDL1, ORMDL2 and ORMDL3.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ORMDL3 Products

Bioinformatics Tool for ORMDL3 Antibody (NBP1-98511)

Discover related pathways, diseases and genes to ORMDL3 Antibody (NBP1-98511). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORMDL3 Antibody (NBP1-98511)

Discover more about diseases related to ORMDL3 Antibody (NBP1-98511).
 

Pathways for ORMDL3 Antibody (NBP1-98511)

View related products by pathway.

PTMs for ORMDL3 Antibody (NBP1-98511)

Learn more about PTMs related to ORMDL3 Antibody (NBP1-98511).

Blogs on ORMDL3

There are no specific blogs for ORMDL3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ORMDL3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ORMDL3
Uniprot