ARH Antibody (4G4-D5)

Images

 
Western Blot: ARH Antibody (4G4-D5) [H00026119-M01] - LDLRAP1 monoclonal antibody (M01), clone 4G4-D5 Analysis of LDLRAP1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: ARH Antibody (4G4-D5) [H00026119-M01] - Analysis of monoclonal antibody to LDLRAP1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: ARH Antibody (4G4-D5) [H00026119-M01] - Analysis of monoclonal antibody to LDLRAP1 on formalin-fixed paraffin-embedded human maligant fibrous histiocytoma tissue. Antibody concentration 2 ...read more
Western Blot: ARH Antibody (4G4-D5) [H00026119-M01] - Analysis of LDLRAP1 expression in transfected 293T cell line by LDLRAP1 monoclonal antibody (M01), clone 4G4-D5.Lane 1: LDLRAP1 transfected lysate(29 KDa).Lane 2: ...read more
Sandwich ELISA: ARH Antibody (4G4-D5) [H00026119-M01] - Detection limit for recombinant GST tagged LDLRAP1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
4G4-D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARH Antibody (4G4-D5) Summary

Immunogen
LDLRAP1 (AAH29770, 1 a.a. ~ 263 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGTEQDDLFSF
Specificity
LDLRAP1 - low density lipoprotein receptor adaptor protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LDLRAP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using H00026119-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARH Antibody (4G4-D5)

  • ARH1
  • ARH2
  • ARHAutosomal recessive hypercholesterolemia protein
  • DKFZp586D0624
  • FHCB1ARH1
  • FHCB2LDL receptor adaptor protein
  • low density lipoprotein receptor adapter protein 1
  • low density lipoprotein receptor adaptor protein 1
  • MGC34705

Background

The protein encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-92873
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88262
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF8064
Species: Hu
Applications: WB, IHC, ICC
NBP1-88835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-527
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC

Publications for ARH Antibody (H00026119-M01)(2)

Reviews for ARH Antibody (H00026119-M01) (0)

There are no reviews for ARH Antibody (H00026119-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARH Antibody (H00026119-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARH Products

Array H00026119-M01

Bioinformatics Tool for ARH Antibody (H00026119-M01)

Discover related pathways, diseases and genes to ARH Antibody (H00026119-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARH Antibody (H00026119-M01)

Discover more about diseases related to ARH Antibody (H00026119-M01).
 

Pathways for ARH Antibody (H00026119-M01)

View related products by pathway.

PTMs for ARH Antibody (H00026119-M01)

Learn more about PTMs related to ARH Antibody (H00026119-M01).

Blogs on ARH

There are no specific blogs for ARH, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARH Antibody (4G4-D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol LDLRAP1
Entrez
OMIM
Uniprot