TAGAP Antibody

Images

 
Western Blot: TAGAP Antibody [NBP1-88826] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-567
Immunocytochemistry/ Immunofluorescence: TAGAP Antibody [NBP1-88826] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: TAGAP Antibody [NBP1-88826] - Staining of human lateral ventricle shows strong cytoplasmic positivity in glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAGAP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLEHTDSSDVSTLQNDSAYDSNDPDVESNSSSGISSPSRQPQVPMATAAGLDSAGPQDAREVSPEPIVSTVARLKSSLAQPDRRYSEPSMPSSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAGAP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAGAP Protein (NBP1-88826PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAGAP Antibody

  • FLJ32631
  • FLJ39771
  • IDDM21
  • MGC133247
  • MGC27381
  • TAGAP1
  • T-cell activation GTPase activating protein
  • T-cell activation GTPase-activating protein
  • T-cell activation Rho GTPase-activating protein
  • T-cell activation RhoGTPase activating protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00641
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF856
Species: Mu
Applications: WB, Flow, CyTOF-ready, Neut
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
594-ML/CF
Species: Mu
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP2-01872
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
AF2988
Species: Mu, Rt
Applications: WB
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
MAB342
Species: Hu
Applications: WB, AgAct
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NBP1-88826
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TAGAP Antibody (NBP1-88826) (0)

There are no publications for TAGAP Antibody (NBP1-88826).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAGAP Antibody (NBP1-88826) (0)

There are no reviews for TAGAP Antibody (NBP1-88826). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAGAP Antibody (NBP1-88826) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAGAP Products

Bioinformatics Tool for TAGAP Antibody (NBP1-88826)

Discover related pathways, diseases and genes to TAGAP Antibody (NBP1-88826). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAGAP Antibody (NBP1-88826)

Discover more about diseases related to TAGAP Antibody (NBP1-88826).
 

Pathways for TAGAP Antibody (NBP1-88826)

View related products by pathway.

Blogs on TAGAP

There are no specific blogs for TAGAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAGAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAGAP