DDX54 Antibody - BSA Free

Immunohistochemistry-Paraffin: DDX54 Antibody [NBP1-89028] - Staining of human kidney shows moderate to strong nucleolar positivity in cells in tubules.

Immunohistochemistry-Paraffin: DDX54 Antibody [NBP1-89028] - Staining of human skeletal muscle shows weak to moderate positivity in nucleoli of myocytes.

Immunohistochemistry-Paraffin: DDX54 Antibody [NBP1-89028] - Staining of human cerebral cortex shows moderate to strong positivity in nucleoli of neurons.

Immunohistochemistry-Paraffin: DDX54 Antibody [NBP1-89028] - Staining of human fallopian tube shows weak to moderate positivity in nucleoli of glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX54 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DDX54 Antibody - BSA Free (NBP1-89028) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VDTKLNEQLKTSFFLVREDTKAAVLLHLLHNVVRPQDQTVVFVATKHHAEYLTELLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVTDLAARGLDIPLLDNVINYSFP
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX54
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DDX54 Protein (NBP1-89028PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DDX54 Antibody - BSA Free

• APR-5
• ATP-dependent RNA helicase DP97
• DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
• DEAD box helicase 97 KDa
• DEAD box protein 54
• DEAD box RNA helicase 97 kDa
• DP97ATP-dependent RNA helicase DDX54
• EC 3.6.1
• EC 3.6.4.13
• MGC2835

Background

DDX54 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The nucleolar protein encoded by this gene interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. Alternative splice variants that encode different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX54