DDX56 Antibody (4C5)

Images

 
Western Blot: DDX56 Antibody (4C5) [H00054606-M05] - Analysis of DDX56 expression in PC-12 (Cat # L012V1).
Immunocytochemistry/ Immunofluorescence: DDX56 Antibody (4C5) [H00054606-M05] - Analysis of monoclonal antibody to DDX56 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: DDX56 Antibody (4C5) [H00054606-M05] - Analysis of monoclonal antibody to DDX56 on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml
Western Blot: DDX56 Antibody (4C5) [H00054606-M05] - Analysis of DDX56 expression in HeLa (Cat # L013V1).
Western Blot: DDX56 Antibody (4C5) [H00054606-M05] - Analysis of DDX56 expression in transfected 293T cell line by DDX56 monoclonal antibody (M05), clone 4C5. Lane 1: DDX56 transfected lysatE (62 KDa). Lane 2: ...read more
Sandwich ELISA: DDX56 Antibody (4C5) [H00054606-M05] - Detection limit for recombinant GST tagged DDX56 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
4C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DDX56 Antibody (4C5) Summary

Immunogen
DDX56 (NP_061955, 450 a.a. ~ 547 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS
Specificity
DDX56 - DEAD (Asp-Glu-Ala-Asp) box polypeptide 56
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DDX56
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against recominant protein, transfected lysate and cell lysate for Western Blot. Has also been used for immunofluorescence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publication using
H00054606-M05 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human & Rat. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DDX56 Antibody (4C5)

  • ATP-dependent 61 kDa nucleolar RNA helicase
  • DDX26
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 56
  • DEAD box protein 21
  • DEAD box protein 56
  • DEAD-box RNA helicase
  • EC 3.6.1
  • EC 3.6.4.13,61-kd nucleolar helicase
  • NOH61DDX21
  • probable ATP-dependent RNA helicase DDX56
  • putative nucleolar RNA helicase

Background

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene shows ATPase activity in the presence of polynucleotides and associates with nucleoplasmic 65S preribosomal particles. This gene may be involved in ribosome synthesis, most likely during assembly of the large 60S ribosomal subunit.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52457
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB200-351
Species: Hu, Mu, Ha
Applications: WB, IHC, IHC-P, IP
NB200-191
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2030
Species: Hu
Applications: WB, IHC
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24632
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, IHC, IHC-P
NBP1-90113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-82485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Po
Applications: WB, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52454
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
NBP1-85302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-68240
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-66826
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NBP2-16134
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00054606-M05
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for DDX56 Antibody (H00054606-M05)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DDX56 Antibody (H00054606-M05) (0)

There are no reviews for DDX56 Antibody (H00054606-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX56 Antibody (H00054606-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DDX56 Products

Bioinformatics Tool for DDX56 Antibody (H00054606-M05)

Discover related pathways, diseases and genes to DDX56 Antibody (H00054606-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX56 Antibody (H00054606-M05)

Discover more about diseases related to DDX56 Antibody (H00054606-M05).
 

Pathways for DDX56 Antibody (H00054606-M05)

View related products by pathway.

Blogs on DDX56

There are no specific blogs for DDX56, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX56 Antibody (4C5) and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX56
Entrez
OMIM
Uniprot