DDAH2 Antibody - BSA Free

Western Blot: DDAH2 Antibody [NBP1-58859] - Titration: 1 ug/ml Positive Control: Fetal Brain Lysate.

Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus Tissue, 5.0ug/ml.

Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus.

Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DDAH2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to DDAH2 (dimethylarginine dimethylaminohydrolase 2). The peptide sequence was selected from the N-terminal of DDAH2 (NP_039268). Peptide sequence MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDAH2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DDAH2 Antibody - BSA Free

• DDAHII
• dimethylargininase-2
• dimethylarginine dimethylaminohydrolase 2G6a
• dimethylarginine dimethylaminohydrolase II
• EC 3.5.3.18
• G6a
• N(G)
• N(G)-dimethylarginine dimethylaminohydrolase 2
• NG30
• NG-dimethylarginine dimethylamino hydrolase homolog
• S-phase protein

Background

DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for DDAH2 Antibody (NBP1-58859). (Showing 1 - 1 of 1 FAQ).

1. I ran a blast on the immunogen sequence used to raise the antibody (cat# NBP1-58859) and the sequence has been identified as coiled-coil domain-containing protein 54. Are you sure about your information? The blot looks good on the datasheet but I am not confident with it.
   • This is a mistake on our website and I have confirmed with the lab that this antibody is, in fact, specific for DDHA2.

Bioinformatics

• Gene Symbol: DDAH2
• Entrez:
  • 23564(Human)
• Uniprot:
  • O95865(Human)