DDAH2 Antibody

Images

 
Western Blot: DDAH2 Antibody [NBP1-58859] - Titration: 1 ug/ml Positive Control: Fetal Brain Lysate.
Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus Tissue, 5.0ug/ml.
Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus.
Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDAH2 Antibody Summary

Immunogen
Synthetic peptides corresponding to DDAH2(dimethylarginine dimethylaminohydrolase 2) The peptide sequence was selected from the N terminal of DDAH2 (NP_039268). Peptide sequence MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDAH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
DDAH2 Protein (NBP1-58859PEP)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DDAH2 Antibody

  • DDAHII
  • dimethylargininase-2
  • dimethylarginine dimethylaminohydrolase 2G6a
  • dimethylarginine dimethylaminohydrolase II
  • EC 3.5.3.18
  • G6a
  • N(G)
  • N(G)-dimethylarginine dimethylaminohydrolase 2
  • NG30
  • NG-dimethylarginine dimethylamino hydrolase homolog
  • S-phase protein

Background

DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-85273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for DDAH2 Antibody (NBP1-58859) (0)

There are no publications for DDAH2 Antibody (NBP1-58859).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDAH2 Antibody (NBP1-58859) (0)

There are no reviews for DDAH2 Antibody (NBP1-58859). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDAH2 Antibody (NBP1-58859). (Showing 1 - 1 of 1 FAQ).

  1. I ran a blast on the immunogen sequence used to raise the antibody (cat# NBP1-58859) and the sequence has been identified as coiled-coil domain-containing protein 54. Are you sure about your information? The blot looks good on the datasheet but I am not confident with it.
    • This is a mistake on our website and I have confirmed with the lab that this antibody is, in fact, specific for DDHA2.

Secondary Antibodies

 

Isotype Controls

Additional DDAH2 Products

Bioinformatics Tool for DDAH2 Antibody (NBP1-58859)

Discover related pathways, diseases and genes to DDAH2 Antibody (NBP1-58859). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDAH2 Antibody (NBP1-58859)

Discover more about diseases related to DDAH2 Antibody (NBP1-58859).
 

Pathways for DDAH2 Antibody (NBP1-58859)

View related products by pathway.

PTMs for DDAH2 Antibody (NBP1-58859)

Learn more about PTMs related to DDAH2 Antibody (NBP1-58859).
 

Research Areas for DDAH2 Antibody (NBP1-58859)

Find related products by research area.

Blogs on DDAH2

There are no specific blogs for DDAH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDAH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDAH2
Entrez
Uniprot