DCI Antibody - BSA Free

Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Analysis in human duodenum and tonsil tissues using NBP1-91822 antibody. Corresponding ECI1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human cerebral cortex, kidney, liver and testis using Anti-ECI1 antibody NBP1-91822 (A) shows similar protein distribution across tissues to independent antibody NBP1-91821 (B).

Western Blot: DCI Antibody [NBP1-91822] - Analysis using Anti-ECI1 antibody NBP1-91822 (A) shows similar pattern to independent antibody NBP1-91821 (B).

Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human tonsil shows very weak granular ctyoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Staining of human duodenum).

Staining of human tonsil shows very weak granular cytoplasmic positivity in germinal center cells.

Analysis in human duodenum and tonsil tissues using NBP1-91822 antibody. Corresponding ECI1 RNA-seq data are presented for the same tissues.

Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DCI Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DCI Antibody - BSA Free (NBP1-91822) is a polyclonal antibody validated for use in IHC and WB. Anti-DCI Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FGSQRVLVEPDAGAGVAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ECI1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DCI Protein (NBP1-91822PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DCI Antibody - BSA Free

• acetylene-allene isomerase
• D2-enoyl-CoA isomerase
• D3
• DCI3,2-trans-enoyl-CoA isomerase3,2 trans-enoyl-CoA isomerase
• Delta(2)-enoyl-CoA isomerase
• Delta(3)
• delta3, delta2-enoyl-CoA isomerase
• dodecenoyl-CoA delta isomerase (3,2 trans-enoyl-CoA isomerase)
• dodecenoyl-CoA isomerase3,2-trans-enoyl-CoA isomerase, mitochondrial
• dodecenoyl-Coenzyme A delta isomerase (3,2 trans-enoyl-Coenzyme A isomerase)
• EC 5.3.3.8
• enoyl-CoA delta isomerase 13,2 trans-enoyl-Coenzyme A isomerase

Background

The DCI gene encodes a member of the hydratase/isomerase superfamily. The protein encoded is a key mitochondrial enzyme involved in beta-oxidation of unsaturated fatty acids. It catalyzes the transformation of 3-cis and 3-trans-enoyl-CoA esters arising durin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DCI Antibody (NBP1-91822)(1)

Publication using NBP1-91822

• Bramhecha YM, Guerard KP, Audet-Walsh e et al. Fatty acid oxidation enzyme delta3, delta2-enoyl-CoA isomerase 1 (ECI1) drives aggressive tumor phenotype and predicts poor clinical outcome in prostate cancer patients Oncogene [PMID: 35411033] (WB, Human)

Bioinformatics

• Gene Symbol: ECI1