Orthogonal Strategies: Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Analysis in human duodenum and tonsil tissues using NBP1-91822 antibody. Corresponding ECI1 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human cerebral cortex, kidney, liver and testis using Anti-ECI1 antibody NBP1-91822 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: DCI Antibody [NBP1-91822] - Analysis using Anti-ECI1 antibody NBP1-91822 (A) shows similar pattern to independent antibody NBP1-91821 (B).
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human tonsil shows very weak granular ctyoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Staining of human duodenum).
Staining of human tonsil shows very weak granular cytoplasmic positivity in germinal center cells.
Orthogonal Strategies: Analysis in human duodenum and tonsil tissues using NBP1-91822 antibody. Corresponding ECI1 RNA-seq data are presented for the same tissues.
Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
This antibody was developed against Recombinant Protein corresponding to amino acids: FGSQRVLVEPDAGAGVAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ECI1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
dodecenoyl-Coenzyme A delta isomerase (3,2 trans-enoyl-Coenzyme A isomerase)
EC 5.3.3.8
enoyl-CoA delta isomerase 13,2 trans-enoyl-Coenzyme A isomerase
Background
The DCI gene encodes a member of the hydratase/isomerase superfamily. The protein encoded is a key mitochondrial enzyme involved in beta-oxidation of unsaturated fatty acids. It catalyzes the transformation of 3-cis and 3-trans-enoyl-CoA esters arising durin
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our DCI Antibody - BSA Free and receive a gift card or discount.