![Immunohistochemistry-Paraffin: DC-LAMP Antibody [NBP2-33616] - Analysis in human lung and skeletal muscle tissues. Corresponding LAMP3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DC-LAMP-Antibody-Immunohistochemistry-Paraffin-NBP2-33616-img0008.jpg "Immunohistochemistry-Paraffin: DC-LAMP Antibody [NBP2-33616] - Analysis in human lung and skeletal muscle tissues. Corresponding LAMP3 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit DC-LAMP Antibody - BSA Free (NBP2-33616) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-DC-LAMP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNAT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LAMP3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry CCR7 Antibody (150503) [Unconjugated]](https://images.novusbio.com/images2/CCR7_MAB197_Immunocytochemistry_6580.jpg)
![Immunohistochemistry CCR7 Antibody (150503) [Unconjugated]](https://images.novusbio.com/images2/CCR7_MAB197_Immunohistochemistry_22800.jpg)
![Neutralization CCR7 Antibody (150503) [Unconjugated]](https://images.novusbio.com/images2/CCR7_MAB197_Block_Neutralize_9048.jpg)
| Publication using NBP2-33616 | Applications | Species |
|---|---|---|
| Dyduch G, Tyrak KE, Glajcar A et al. Melanomas and dysplastic nevi differ in epidermal CD1 c+ dendritic cell count. BioMed Research International. 2017-02-26 [PMID: 28331853] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for DC-LAMP Antibody (NBP2-33616)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: DC-LAMP Antibody [NBP2-33616] - Staining of human cell line HEK 293 shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/DC-LAMP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33616-img0007.jpg "Immunocytochemistry/Immunofluorescence: DC-LAMP Antibody [NBP2-33616] - Staining of human cell line HEK 293 shows localization to vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: DC-LAMP Antibody [NBP2-33616] - Staining of human lung shows strong cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/DC-LAMP-Antibody-Immunohistochemistry-Paraffin-NBP2-33616-img0012.jpg "Immunohistochemistry-Paraffin: DC-LAMP Antibody [NBP2-33616] - Staining of human lung shows strong cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: DC-LAMP Antibody [NBP2-33616] - Staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/DC-LAMP-Antibody-Immunohistochemistry-Paraffin-NBP2-33616-img0009.jpg "Immunohistochemistry-Paraffin: DC-LAMP Antibody [NBP2-33616] - Staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: DC-LAMP Antibody [NBP2-33616] - Staining of human lymphoid tissues shows strong cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/DC-LAMP-Antibody-Immunohistochemistry-Paraffin-NBP2-33616-img0010.jpg "Immunohistochemistry-Paraffin: DC-LAMP Antibody [NBP2-33616] - Staining of human lymphoid tissues shows strong cytoplasmic positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: DC-LAMP Antibody [NBP2-33616] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/DC-LAMP-Antibody-Immunohistochemistry-Paraffin-NBP2-33616-img0011.jpg "Immunohistochemistry-Paraffin: DC-LAMP Antibody [NBP2-33616] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![LAMP Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "LAMP Antibody [Unconjugated]")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]](https://images.novusbio.com/images2/DC-SIGN_MAB161_Flow_Cytometry_1930.jpg)
![Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]](https://images.novusbio.com/images2/DC-SIGN_MAB161_Flow_Cytometry_9298.jpg)
![Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]](https://images.novusbio.com/images/mab161_human-dc-sign-cd209-mab-clone-120507-41202412512689.jpg)
![Immunocytochemistry OBCAM/OPCML Antibody [Unconjugated]](https://images.novusbio.com/images2/OBCAM_AF2777_Immunocytochemistry__Immunofluorescence_19986.jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/CD40_Ligand_DCDL40_ELISA_60.jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/DATA_CD40_Ligand_DCDL40_ELISA_624.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")