DAD1 Antibody - BSA Free

Western Blot: DAD1 Antibody [NBP3-35461] - Western blot analysis of various lysates using DAD1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5min.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DAD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DAD1 Antibody - BSA Free (NBP3-35461) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DAD1 (NP_001335.1).
  
  Sequence:
  MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DAD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 12 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for DAD1 Antibody - BSA Free

• DAD-1
• defender against cell death 1EC 2.4.1.119
• dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
• Oligosaccharyl transferase subunit DAD1
• oligosaccharyltransferase 2 homolog
• OST2

Background

Defender of cell death 1 (DAD1) was initially discovered in BHK21 cells as a negative regulator of programmed cell death, a process important for normal organism development and tissue homeostasis. DAD1 was later shown to be a subunit of the mammalian oligosaccharyltransferase complex and is required for its function and structural integrity. Mice lacking DAD1 express abnormal N-linked glycoproteins and undergo increased apoptotic-associated embryonic death. Furthermore, overexpression of DAD1 mRNA is seen in some human hepatocellular carcinomas, indicating it may also play a role in carcinogenesis. It should be noted that DAD1 is not related to the inhibitor of apoptosis proteins (IAP) family and does not contain any baculoviral IAP repeat (BIR) domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DAD1