WBP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WBP1 Antibody [NBP2-31660] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: WBP1 Antibody [NBP2-31660] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WBP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WBP1 Protein (NBP2-31660PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WBP1 Antibody

  • WBP-1MGC15305
  • WW domain binding protein 1
  • WW domain-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01294
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46439
Species: Hu
Applications: WB, IHC
NBP1-80835
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81763
Species: Hu
Applications: IHC, IHC-P
H00023558-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-669
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-31660
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for WBP1 Antibody (NBP2-31660) (0)

There are no publications for WBP1 Antibody (NBP2-31660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WBP1 Antibody (NBP2-31660) (0)

There are no reviews for WBP1 Antibody (NBP2-31660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WBP1 Antibody (NBP2-31660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WBP1 Products

Bioinformatics Tool for WBP1 Antibody (NBP2-31660)

Discover related pathways, diseases and genes to WBP1 Antibody (NBP2-31660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WBP1 Antibody (NBP2-31660)

Discover more about diseases related to WBP1 Antibody (NBP2-31660).
 

Pathways for WBP1 Antibody (NBP2-31660)

View related products by pathway.

PTMs for WBP1 Antibody (NBP2-31660)

Learn more about PTMs related to WBP1 Antibody (NBP2-31660).

Blogs on WBP1

There are no specific blogs for WBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WBP1
Uniprot