DNAH5 Antibody

Images

 
Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human nasopharynx shows strong positivity in the cilia of respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAH5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAH5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAH5 Protein (NBP1-84463PEP)
Publications
Read Publications using
NBP1-84463 in the following applications:

  • IP
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%). Reactivity reported in scientific literature (PMID: 24203976)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAH5 Antibody

  • Axonemal beta dynein heavy chain 5
  • CILD3KIAA1603
  • Ciliary dynein heavy chain 5
  • dynein heavy chain 5, axonemal
  • dynein, axonemal, heavy chain 5
  • dynein, axonemal, heavy polypeptide 5
  • FLJ46759
  • HL1DNAHC5
  • KTGNR
  • PCDDnahc5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB5657
Species: Hu
Applications: WB, IP, ICC
NBP1-84067
Species: Hu
Applications: IHC, IHC-P
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC

Publications for DNAH5 Antibody (NBP1-84463)(3)

Reviews for DNAH5 Antibody (NBP1-84463) (0)

There are no reviews for DNAH5 Antibody (NBP1-84463). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAH5 Antibody (NBP1-84463) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAH5 Products

Bioinformatics Tool for DNAH5 Antibody (NBP1-84463)

Discover related pathways, diseases and genes to DNAH5 Antibody (NBP1-84463). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAH5 Antibody (NBP1-84463)

Discover more about diseases related to DNAH5 Antibody (NBP1-84463).
 

Pathways for DNAH5 Antibody (NBP1-84463)

View related products by pathway.

Blogs on DNAH5

There are no specific blogs for DNAH5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAH5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAH5