DNAH5 Antibody

Images

 
Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human nasopharynx shows strong positivity in the cilia of respiratory epithelial cells.
Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining in human fallopian tube and liver tissues using anti-DNAH5 antibody. Corresponding DNAH5 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human lymph node.
Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human nasopharynx.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Analysis in human fallopian tube and liver tissues. Corresponding DNAH5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Independent Antibodies: Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human cerebral cortex, fallopian tube, liver and nasopharynx using Anti-DNAH5 antibody NBP1-84463 (A) shows similar ...read more
Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAH5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD
Specificity
Specificity of human DNAH5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAH5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IP reported in the scientific literature (PMID: 25232951).
Control Peptide
DNAH5 Protein (NBP1-84463PEP)
Publications
Read Publications using
NBP1-84463 in the following applications:

  • IP
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Reactivity reported in scientific literature (PMID: 24203976)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAH5 Antibody

  • Axonemal beta dynein heavy chain 5
  • CILD3KIAA1603
  • Ciliary dynein heavy chain 5
  • dynein heavy chain 5, axonemal
  • dynein, axonemal, heavy chain 5
  • dynein, axonemal, heavy polypeptide 5
  • FLJ46759
  • HL1DNAHC5
  • KTGNR
  • PCDDnahc5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, Func, IHC, IHC-Fr
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP2-93878
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56116
Species: Hu, Mu, Rt, Ma
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84556
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84067
Species: Hu
Applications: IHC, IHC-P
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, KO

Publications for DNAH5 Antibody (NBP1-84463)(3)

Reviews for DNAH5 Antibody (NBP1-84463) (0)

There are no reviews for DNAH5 Antibody (NBP1-84463). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAH5 Antibody (NBP1-84463) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DNAH5 Products

Array NBP1-84463

Bioinformatics Tool for DNAH5 Antibody (NBP1-84463)

Discover related pathways, diseases and genes to DNAH5 Antibody (NBP1-84463). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAH5 Antibody (NBP1-84463)

Discover more about diseases related to DNAH5 Antibody (NBP1-84463).
 

Pathways for DNAH5 Antibody (NBP1-84463)

View related products by pathway.

Blogs on DNAH5

There are no specific blogs for DNAH5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAH5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAH5