DNAI1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84466] - Staining in human testis and prostate tissues using NBP1-84466 antibody. Corresponding DNAI1 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84466] - Staining of human fallopian tube, placenta, prostate and testis using Anti-DNAI1 antibody NBP1-84466 (A) shows similar protein ...read more
Western Blot: DNAI1 Antibody [NBP1-84466] - Analysis in control (vector only transfected HEK293T lysate) and dNAI1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84466] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84466] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84466] - Staining of human prostate shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: DNAI1 Antibody [NBP1-84466] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAI1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 25700162). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAI1 Protein (NBP1-84466PEP)
Publications
Read Publications using
NBP1-84466 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (80%). Reactivity reported in scientific literature (PMID: 24298994)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAI1 Antibody

  • Axonemal dynein intermediate chain 1
  • CILD1MGC26204
  • dynein intermediate chain DNAI1
  • dynein, axonemal, intermediate chain 1
  • dynein, axonemal, intermediate polypeptide 1
  • ICS
  • ICS1
  • immotile cilia syndrome 1
  • PCDdynein intermediate chain 1, axonemal

Background

The inner- and outer-arm dyneins, which bridge between the doublet microtubules in axonemes, are the force-generatingproteins responsible for the sliding movement in axonemes. The intermediate and light chains, thought to form the baseof the dynein arm, help mediate attachment and may also participate in regulating dynein activity. This gene encodesan intermediate chain dynein, belonging to the large family of motor proteins. Mutations in this gene result inabnormal ciliary ultrastructure and function associated with primary ciliary dyskinesia (PCD) and Kartagener syndrome.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
202-IL
Species: Hu
Applications: BA
NBP2-93878
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-29373
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-84556
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1457
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for DNAI1 Antibody (NBP1-84466)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DNAI1 Antibody (NBP1-84466) (0)

There are no reviews for DNAI1 Antibody (NBP1-84466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAI1 Antibody (NBP1-84466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAI1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAI1