Cytokeratin 13 Antibody

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining in human cervix, uterine and skeletal muscle tissues.. Corresponding KRT13 RNA-seq data are presented for the same tissues.

Western Blot: Cytokeratin 13 Antibody [NBP2-38166] - Analysis in human cell lines A-431 and HEK293 using anti-KRT13 antibody. Corresponding KRT13 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human cell line A-431 shows localization to intermediate filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human prostate shows positivity in the basal layer.

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human skin shows positivity in epidermal cells.

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human cervix shows positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Cytokeratin 13 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cytokeratin 13 Protein (NBP2-38166PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cytokeratin 13 Antibody

• CK13
• CK-13
• cytokeratin 13
• Cytokeratin-13
• K13cytokeratin-13
• keratin 13
• keratin, type I cytoskeletal 13
• keratin-13
• MGC161462
• MGC3781

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KRT13
• Uniprot:
  • P13646(Human)