Cytokeratin 13 Antibody

Images

 
Orthogonal Strategies: Western Blot: Cytokeratin 13 Antibody [NBP2-38166] - Analysis in human cell lines A-431 and HEK293 using anti-KRT13 antibody. Corresponding KRT13 RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: Cytokeratin 13 Antibody [NBP2-38166] - Immunofluorescent staining of human cell line A-431 shows localization to intermediate filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human prostate shows positivity in the basal layer.
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human skin shows positivity in epidermal cells.
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human cervix shows positivity in squamous epithelial cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining in human cervix, uterine and skeletal muscle tissues.. Corresponding KRT13 RNA-seq data are presented for the ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Cytokeratin 13 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCG
Specificity
Specificity of human Cytokeratin 13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cytokeratin 13 Protein (NBP2-38166PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytokeratin 13 Antibody

  • CK13
  • CK-13
  • cytokeratin 13
  • Cytokeratin-13
  • K13cytokeratin-13
  • keratin 13
  • keratin, type I cytoskeletal 13
  • keratin-13
  • MGC161462
  • MGC3781

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-61736
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, IHC
NBP2-67706
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29429
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC, Single Cell Western
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-67559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP2-38536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85599
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP2-34844
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P
7559-ST
Species: Hu
NBP2-38166
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cytokeratin 13 Antibody (NBP2-38166) (0)

There are no publications for Cytokeratin 13 Antibody (NBP2-38166).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 13 Antibody (NBP2-38166) (0)

There are no reviews for Cytokeratin 13 Antibody (NBP2-38166). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cytokeratin 13 Antibody (NBP2-38166) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Cytokeratin 13 Antibody (NBP2-38166)

Discover related pathways, diseases and genes to Cytokeratin 13 Antibody (NBP2-38166). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 13 Antibody (NBP2-38166)

Discover more about diseases related to Cytokeratin 13 Antibody (NBP2-38166).
 

Pathways for Cytokeratin 13 Antibody (NBP2-38166)

View related products by pathway.

PTMs for Cytokeratin 13 Antibody (NBP2-38166)

Learn more about PTMs related to Cytokeratin 13 Antibody (NBP2-38166).
 

Research Areas for Cytokeratin 13 Antibody (NBP2-38166)

Find related products by research area.

Blogs on Cytokeratin 13

There are no specific blogs for Cytokeratin 13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin 13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT13
Uniprot