cysteine/histidine-rich 1 Antibody


Immunocytochemistry/ Immunofluorescence: cysteine/histidine-rich 1 Antibody [NBP2-30428] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: cysteine/histidine-rich 1 Antibody [NBP2-30428] - Staining of human testis shows nuclear positivity in cells in seminiferous.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

cysteine/histidine-rich 1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ
Specificity of human cysteine/histidine-rich 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
cysteine/histidine-rich 1 Protein (NBP2-30428PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for cysteine/histidine-rich 1 Antibody

  • CHRP
  • cysteine and histidine rich 1
  • cysteine and histidine-rich protein 1
  • cysteine/histidine-rich 1
  • KIAA0496cysteine and histidine rich protein
  • MGC13010


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for cysteine/histidine-rich 1 Antibody (NBP2-30428) (0)

There are no publications for cysteine/histidine-rich 1 Antibody (NBP2-30428).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cysteine/histidine-rich 1 Antibody (NBP2-30428) (0)

There are no reviews for cysteine/histidine-rich 1 Antibody (NBP2-30428). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for cysteine/histidine-rich 1 Antibody (NBP2-30428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional cysteine/histidine-rich 1 Products

Bioinformatics Tool for cysteine/histidine-rich 1 Antibody (NBP2-30428)

Discover related pathways, diseases and genes to cysteine/histidine-rich 1 Antibody (NBP2-30428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for cysteine/histidine-rich 1 Antibody (NBP2-30428)

Discover more about diseases related to cysteine/histidine-rich 1 Antibody (NBP2-30428).

Pathways for cysteine/histidine-rich 1 Antibody (NBP2-30428)

View related products by pathway.

PTMs for cysteine/histidine-rich 1 Antibody (NBP2-30428)

Learn more about PTMs related to cysteine/histidine-rich 1 Antibody (NBP2-30428).

Blogs on cysteine/histidine-rich 1

There are no specific blogs for cysteine/histidine-rich 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our cysteine/histidine-rich 1 Antibody and receive a gift card or discount.


Gene Symbol CYHR1