cysteine/histidine-rich 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: cysteine/histidine-rich 1 Antibody [NBP2-30428] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: cysteine/histidine-rich 1 Antibody [NBP2-30428] - Staining of human testis shows nuclear positivity in cells in seminiferous.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

cysteine/histidine-rich 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYHR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
cysteine/histidine-rich 1 Protein (NBP2-30428PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for cysteine/histidine-rich 1 Antibody

  • CHRP
  • cysteine and histidine rich 1
  • cysteine and histidine-rich protein 1
  • cysteine/histidine-rich 1
  • KIAA0496cysteine and histidine rich protein
  • MGC13010

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF662
Species: Mu
Applications: WB, IHC
NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3760
Species: Hu
Applications: WB
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92301
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30428
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for cysteine/histidine-rich 1 Antibody (NBP2-30428) (0)

There are no publications for cysteine/histidine-rich 1 Antibody (NBP2-30428).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cysteine/histidine-rich 1 Antibody (NBP2-30428) (0)

There are no reviews for cysteine/histidine-rich 1 Antibody (NBP2-30428). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for cysteine/histidine-rich 1 Antibody (NBP2-30428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional cysteine/histidine-rich 1 Products

Bioinformatics Tool for cysteine/histidine-rich 1 Antibody (NBP2-30428)

Discover related pathways, diseases and genes to cysteine/histidine-rich 1 Antibody (NBP2-30428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for cysteine/histidine-rich 1 Antibody (NBP2-30428)

Discover more about diseases related to cysteine/histidine-rich 1 Antibody (NBP2-30428).
 

Pathways for cysteine/histidine-rich 1 Antibody (NBP2-30428)

View related products by pathway.

PTMs for cysteine/histidine-rich 1 Antibody (NBP2-30428)

Learn more about PTMs related to cysteine/histidine-rich 1 Antibody (NBP2-30428).

Blogs on cysteine/histidine-rich 1

There are no specific blogs for cysteine/histidine-rich 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our cysteine/histidine-rich 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYHR1
Uniprot