CYP7B1 Antibody

Images

 
Immunohistochemistry: CYP7B1 Antibody [NBP1-87013] - Staining of human small intestine shows strong membranous, and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP7B1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLESSIFEALRLSSYSTTIRFVEEDLTLSSETGDYCVRKGDLVAIFPPVLHGDPEIFEAPEEFRYDRFIEDGKKKTTFFKRGKKLKCYLMPFGTGTSKC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP7B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CYP7B1 Protein (NBP1-87013PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYP7B1 Antibody

  • CBAS3
  • CP7B
  • Cytochrome P450 7B1
  • cytochrome P450, family 7, subfamily B, polypeptide 1
  • cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1,25-hydroxycholesterol 7-alpha-hydroxylase
  • EC 1.14.13.100
  • Oxysterol 7-alpha-hydroxylase
  • oxysterol 7alpha-hydroxylase
  • spastic paraplegia 5A (autosomal recessive)
  • SPG5A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9120
Species: Hu
Applications: ICC
NB400-153
Species: Hu
Applications: WB, ICC/IF
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-50218
Species: Hu, Rt
Applications: WB, ELISA, IHC
NB400-157
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western
NBP2-50206
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-87013
Species: Hu
Applications: IHC, IHC-P

Publications for CYP7B1 Antibody (NBP1-87013) (0)

There are no publications for CYP7B1 Antibody (NBP1-87013).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP7B1 Antibody (NBP1-87013) (0)

There are no reviews for CYP7B1 Antibody (NBP1-87013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CYP7B1 Antibody (NBP1-87013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP7B1 Products

Bioinformatics Tool for CYP7B1 Antibody (NBP1-87013)

Discover related pathways, diseases and genes to CYP7B1 Antibody (NBP1-87013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP7B1 Antibody (NBP1-87013)

Discover more about diseases related to CYP7B1 Antibody (NBP1-87013).
 

Pathways for CYP7B1 Antibody (NBP1-87013)

View related products by pathway.

PTMs for CYP7B1 Antibody (NBP1-87013)

Learn more about PTMs related to CYP7B1 Antibody (NBP1-87013).

Blogs on CYP7B1

There are no specific blogs for CYP7B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP7B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP7B1