ROR alpha/NR1F1 Antibody


Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gt, Gp, Rb, ZeSpecies Glossary
Applications WB, ICC/IF

Order Details

ROR alpha/NR1F1 Antibody Summary

Synthetic peptides corresponding to RORA (RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA (P35398-3). Peptide sequence CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Goat (93%), Equine (100%), Zebrafish (93%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.25 ug/ml
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This is a rabbit polyclonal antibody against RORA and was validated on Western blot and is useful in Immunofluorescence (PMID: 21480365).
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publications using NBP1-52813.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ROR alpha/NR1F1 Antibody

  • DKFZp686M2414
  • MGC119326
  • NR1F1
  • NR1F1MGC119329
  • nuclear receptor ROR-alpha
  • Nuclear receptor RZR-alpha
  • Nuclear receptor subfamily 1 group F member 1
  • RAR-related orphan receptor A
  • RAR-related orphan receptor alpha
  • retinoic acid receptor-related orphan receptor alpha
  • retinoid-related orphan receptor alpha
  • Retinoid-related orphan receptor-alpha
  • ROR alpha
  • ROR1
  • ROR2
  • ROR3
  • RORA
  • RZRA
  • RZRAROR-alpha
  • transcription factor RZR-alpha


The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, KO
Species: Hu, Bv, Ca
Applications: IHC, IHC-P, ICC
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, RNAi
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, Gp, Rb, Ze
Applications: WB, ICC/IF

Publications for ROR alpha/NR1F1 Antibody (NBP1-52813)(2)

Reviews for ROR alpha/NR1F1 Antibody (NBP1-52813) (0)

There are no reviews for ROR alpha/NR1F1 Antibody (NBP1-52813). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ROR alpha/NR1F1 Antibody (NBP1-52813) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ROR alpha/NR1F1 Products

Bioinformatics Tool for ROR alpha/NR1F1 Antibody (NBP1-52813)

Discover related pathways, diseases and genes to ROR alpha/NR1F1 Antibody (NBP1-52813). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROR alpha/NR1F1 Antibody (NBP1-52813)

Discover more about diseases related to ROR alpha/NR1F1 Antibody (NBP1-52813).

Pathways for ROR alpha/NR1F1 Antibody (NBP1-52813)

View related products by pathway.

PTMs for ROR alpha/NR1F1 Antibody (NBP1-52813)

Learn more about PTMs related to ROR alpha/NR1F1 Antibody (NBP1-52813).

Blogs on ROR alpha/NR1F1

There are no specific blogs for ROR alpha/NR1F1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ROR alpha/NR1F1 Antibody and receive a gift card or discount.


Gene Symbol RORA