ROR alpha/NR1F1 Antibody

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - Western blot analysis of RORa expression in NP tissues isolated from three rats showed positive expression of the protein. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.8521) licensed under a CC-BY license.

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - HepG2 cell lysate, concentration 1.25ug/ml.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 1 mg/ml

ROR alpha/NR1F1 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RORA (RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA (P35398-3). Peptide sequence CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RORA
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunofluorescence (PMID: 21480365), IHC-P reported in scientific literature (PMID:35803929).
• Theoretical MW: 63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for ROR alpha/NR1F1 Antibody

• DKFZp686M2414
• MGC119326
• NR1F1
• NR1F1MGC119329
• nuclear receptor ROR-alpha
• Nuclear receptor RZR-alpha
• Nuclear receptor subfamily 1 group F member 1
• RAR-related orphan receptor A
• RAR-related orphan receptor alpha
• retinoic acid receptor-related orphan receptor alpha
• retinoid-related orphan receptor alpha
• Retinoid-related orphan receptor-alpha
• ROR alpha
• ROR1
• ROR2
• ROR3
• RORA
• RZRA
• RZR-ALPHA
• RZRAROR-alpha
• transcription factor RZR-alpha

Background

The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ROR alpha/NR1F1 Antibody (NBP1-52813)(4)

Publications using NBP1-52813

• Guerra M, Medici V, Weatheritt R et al. Fetal exposure to valproic acid dysregulates the expression of autism-linked genes in the developing cerebellum Translational psychiatry 2023-04-05 [PMID: 37019889] (WB, Mouse)
• Li J, Liu H, Wang X et al. Melatonin ameliorates Parkinson's disease via regulating microglia polarization in a ROR alpha-dependent pathway NPJ Parkinson's disease 2022-07-08 [PMID: 35803929] (IHC-P, Mouse)
• Suyama K, Silagi ES, Choi H et al. Circadian factors BMAL1 and RORalpha control HIF-1alpha transcriptional activity in nucleus pulposus cells: implications in maintenance of intervertebral disc health. Oncotarget 2016-04-26 [PMID: 27049729] (WB)
• Benderdour M, Fahmi H, Beaudet F et al. Nuclear receptor retinoid-related orphan receptor [alpha]1 modulates the metabolic activity of human osteoblasts. J Cell Biochem 112(8):2160-2169. 2011-08-01 [PMID: 21480365]

Bioinformatics

• Gene Symbol: RORA
• Entrez:
  • 6095(Human)
• Uniprot:
  • P35398()