ROR alpha/NR1F1 Antibody

Images

 
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ROR alpha/NR1F1 Antibody Summary

Immunogen
Synthetic peptides corresponding to RORA (RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA (P35398-3). Peptide sequence CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RORA
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.25 ug/ml
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This is a rabbit polyclonal antibody against RORA and was validated on Western blot and is useful in Immunofluorescence (PMID: 21480365).
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-52813.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ROR alpha/NR1F1 Antibody

  • DKFZp686M2414
  • MGC119326
  • NR1F1
  • NR1F1MGC119329
  • nuclear receptor ROR-alpha
  • Nuclear receptor RZR-alpha
  • Nuclear receptor subfamily 1 group F member 1
  • RAR-related orphan receptor A
  • RAR-related orphan receptor alpha
  • retinoic acid receptor-related orphan receptor alpha
  • retinoid-related orphan receptor alpha
  • Retinoid-related orphan receptor-alpha
  • ROR alpha
  • ROR1
  • ROR2
  • ROR3
  • RORA
  • RZRA
  • RZR-ALPHA
  • RZRAROR-alpha
  • transcription factor RZR-alpha

Background

The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

645-WN/CF
Species: Hu, Mu
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
AF4649
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF1120
Species: Mu
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
AF1617
Species: Hu
Applications: WB
H00009572-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1927
Species: Hu
Applications: WB, IP, ICC
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF198
Species: Mu
Applications: WB, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7164
Species: Hu
Applications: WB
AF6278
Species: Hu, Mu
Applications: WB

Publications for ROR alpha/NR1F1 Antibody (NBP1-52813)(2)

Reviews for ROR alpha/NR1F1 Antibody (NBP1-52813) (0)

There are no reviews for ROR alpha/NR1F1 Antibody (NBP1-52813). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ROR alpha/NR1F1 Antibody (NBP1-52813) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ROR alpha/NR1F1 Products

Bioinformatics Tool for ROR alpha/NR1F1 Antibody (NBP1-52813)

Discover related pathways, diseases and genes to ROR alpha/NR1F1 Antibody (NBP1-52813). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROR alpha/NR1F1 Antibody (NBP1-52813)

Discover more about diseases related to ROR alpha/NR1F1 Antibody (NBP1-52813).
 

Pathways for ROR alpha/NR1F1 Antibody (NBP1-52813)

View related products by pathway.

PTMs for ROR alpha/NR1F1 Antibody (NBP1-52813)

Learn more about PTMs related to ROR alpha/NR1F1 Antibody (NBP1-52813).
 

Research Areas for ROR alpha/NR1F1 Antibody (NBP1-52813)

Find related products by research area.

Blogs on ROR alpha/NR1F1

There are no specific blogs for ROR alpha/NR1F1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROR alpha/NR1F1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RORA
Entrez
Uniprot