AGXT Antibody - BSA Free

Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Analysis in human liver and pancreas tissues. Corresponding AGXT RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human endometrium, fallopian tube, skin and testis using Anti-NEK1 antibody (A) NBP1-89200 shows similar protein distribution across tissues to independent antibody NBP2-34198 (B).

Western Blot: AGXT Antibody [NBP1-89200] - Analysis in human liver tissue.

Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human liver shows strong granular positivity in cytoplasm in hepatocytes.

Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Simple Western: AGXT Antibody [NBP1-89200] - Simple Western lane view shows a specific band for AGXT in 0.2 mg/ml of Liver (left), HepG2 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: AGXT Antibody [NBP1-89200] - Electropherogram image(s) of corresponding Simple Western lane view. AGXT antibody was used at 1:20 dilution on Liver lysate(s).

Simple Western: AGXT Antibody [NBP1-89200] - Electropherogram image(s) of corresponding Simple Western Lane view. AGXT antibody was used at 1:20 dilution on HepG2 lysate(s).

• Reactivity: Hu, Rt
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AGXT Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGS
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGXT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in Liver, HepG2, separated by Size, antibody dilution of 1:20, apparent MW was 47 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  AGXT Protein (NBP1-89200PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26609667).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AGXT Antibody - BSA Free

• AGT1L-alanine: glyoxylate aminotransferase 1
• AGThepatic peroxisomal alanine:glyoxylate aminotransferase
• AGXT1
• alanine-glyoxylate aminotransferase
• Alanine--glyoxylate aminotransferase
• EC 2.6.1.44
• EC 2.6.1.51
• PH1
• serine:pyruvate aminotransferase
• SPATserine-pyruvate aminotransferase
• SPTserine--pyruvate aminotransferase
• TLH6

Background

AGXT, also known as Serine--pyruvate aminotransferase, is 43kDa and 392 amino acids long. AGXT is localized to the peroxisome and is only expressed in the liver. AGXT is implicated in glyoxylate detoxification and mutations in the AGXT gene have been linked with type I primary hyperoxaluria. AGXT has been shown to have interactions with AGXT2, PEX5, ALAS2, 14-3-3 epsilon and Synphilin-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AGXT Antibody (NBP1-89200)(3)

Publications using NBP1-89200

• Li Y, Zheng R, Xu G, et al. Generation and characterization of a novel rat model of primary hyperoxaluria type 1 with a nonsense mutation in alanine-glyoxylate aminotransferase gene American journal of physiology. Renal physiology 2021-01-25 [PMID: 33491567] (WB)
• Zheng R, Li Y, Wang L et al. CRISPR/Cas9-mediated metabolic pathway reprogramming in a novel humanized rat model ameliorates primary hyperoxaluria type 1 Kidney Int. 2020-05-25 [PMID: 32464217]
• R Castello, R Borzone, S D'Aria et al. Helper-dependent adenoviral vectors for liver-directed gene therapy of primary hyperoxaluria type 1. Gene Therapy 2015-12-24 [PMID: 26609667] (WB, Mouse)

Bioinformatics

• Gene Symbol: AGXT
• Entrez:
  • 189(Human)
• Uniprot:
  • P21549(Human)