CYP11A1 Antibody

Images

 
Western Blot: CYP11A1 Antibody [NBP1-54758] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa
Immunohistochemistry: CYP11A1 Antibody [NBP1-54758] - Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-CYP11A1 antibody
Western Blot: CYP11A1 Antibody [NBP1-54758] - CYP11A1 antibody - middle region validated by WB using Hela cell lysate at 1ug/ml.
Western Blot: CYP11A1 Antibody [NBP1-54758] - Titration: 1 ug/ml Positive Control: Human HK2 cell (kidney proximal tubular cell line).
Western Blot: CYP11A1 Antibody [NBP1-54758] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: CYP11A1 Antibody [NBP1-54758] - Human Placenta
Immunohistochemistry-Paraffin: CYP11A1 Antibody [NBP1-54758] - Human Placenta
Immunohistochemistry-Paraffin: CYP11A1 Antibody [NBP1-54758] - Human Placenta

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP11A1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP11A1(cytochrome P450, family 11, subfamily A, polypeptide 1) The peptide sequence was selected from the N terminal of CYP11A1. Peptide sequence QKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP11A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against CYP11A1 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYP11A1 Antibody

  • Cholesterol desmolase
  • cholesterol monooxygenase (side-chain-cleaving)
  • cholesterol side-chain cleavage enzyme, mitochondrial
  • CYPXIA1
  • Cytochrome P450 11A1
  • Cytochrome P450(scc)
  • cytochrome P450, family 11, subfamily A, polypeptide 1
  • cytochrome P450C11A1
  • EC 1.14.15
  • EC 1.14.15.6
  • steroid 20-22-lyase
  • subfamily XIA (cholesterol side chain cleavage)

Background

CYP11A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP11A1 localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86993
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13891
Species: Hu
Applications: IHC, IHC-P
NBP1-84310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38698
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CYP11A1 Antibody (NBP1-54758) (0)

There are no publications for CYP11A1 Antibody (NBP1-54758).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP11A1 Antibody (NBP1-54758) (0)

There are no reviews for CYP11A1 Antibody (NBP1-54758). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP11A1 Antibody (NBP1-54758) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CYP11A1 Antibody (NBP1-54758)

Discover related pathways, diseases and genes to CYP11A1 Antibody (NBP1-54758). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP11A1 Antibody (NBP1-54758)

Discover more about diseases related to CYP11A1 Antibody (NBP1-54758).
 

Pathways for CYP11A1 Antibody (NBP1-54758)

View related products by pathway.

PTMs for CYP11A1 Antibody (NBP1-54758)

Learn more about PTMs related to CYP11A1 Antibody (NBP1-54758).
 

Research Areas for CYP11A1 Antibody (NBP1-54758)

Find related products by research area.

Blogs on CYP11A1

There are no specific blogs for CYP11A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP11A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP11A1
Uniprot