CYB5R1 Antibody

Images

 
Western Blot: CYB5R1 Antibody [NBP1-83144] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunohistochemistry-Paraffin: CYB5R1 Antibody [NBP1-83144] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

CYB5R1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYB5R1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
CYB5R1 Protein (NBP1-83144PEP)

Alternate Names for CYB5R1 Antibody

  • b5R.1
  • B5R1
  • CYB5BR1
  • cytochrome b5 reductase 1
  • EC 1.6.2.2
  • Humb5R2
  • NAD(P)H:quinone oxidoreductase type 3 polypeptide A2
  • NQO3A2polypeptide A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33192
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
H00145226-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-32509
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF
NBP1-19629
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77904
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00054360-Q01
Species: Hu
NBP1-54778
Species: Hu
Applications: WB
PP-A9033A-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP1-88039
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86792
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-83144
Species: Hu, Mouse, Rat
Applications: WB, IHC, IHC-P

Publications for CYB5R1 Antibody (NBP1-83144) (0)

There are no publications for CYB5R1 Antibody (NBP1-83144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYB5R1 Antibody (NBP1-83144) (0)

There are no reviews for CYB5R1 Antibody (NBP1-83144). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYB5R1 Antibody (NBP1-83144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYB5R1 Antibody Products

Related Products by Gene

Bioinformatics Tool for CYB5R1 Antibody (NBP1-83144)

Discover related pathways, diseases and genes to CYB5R1 Antibody (NBP1-83144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYB5R1 Antibody (NBP1-83144)

Discover more about diseases related to CYB5R1 Antibody (NBP1-83144).
 

Pathways for CYB5R1 Antibody (NBP1-83144)

View related products by pathway.

Blogs on CYB5R1

There are no specific blogs for CYB5R1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CYB5R1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-83144 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought