CYB5R1 Antibody

Images

 
Western Blot: CYB5R1 Antibody [NBP1-83144] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: CYB5R1 Antibody [NBP1-83144] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYB5R1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYB5R1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
CYB5R1 Protein (NBP1-83144PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYB5R1 Antibody

  • b5R.1
  • B5R1
  • CYB5BR1
  • cytochrome b5 reductase 1
  • EC 1.6.2.2
  • Humb5R2
  • NAD(P)H:quinone oxidoreductase type 3 polypeptide A2
  • NQO3A2polypeptide A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
H00145226-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-52553
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
AF2654
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-56413
Species: Hu
Applications: WB, ICC/IF
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00054360-Q01
Species: Hu
NBP1-54778
Species: Hu
Applications: WB
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP1-88039
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86792
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-83144
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CYB5R1 Antibody (NBP1-83144) (0)

There are no publications for CYB5R1 Antibody (NBP1-83144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYB5R1 Antibody (NBP1-83144) (0)

There are no reviews for CYB5R1 Antibody (NBP1-83144). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYB5R1 Antibody (NBP1-83144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYB5R1 Antibody Products

Related Products by Gene

Bioinformatics Tool for CYB5R1 Antibody (NBP1-83144)

Discover related pathways, diseases and genes to CYB5R1 Antibody (NBP1-83144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYB5R1 Antibody (NBP1-83144)

Discover more about diseases related to CYB5R1 Antibody (NBP1-83144).
 

Pathways for CYB5R1 Antibody (NBP1-83144)

View related products by pathway.

Blogs on CYB5R1

There are no specific blogs for CYB5R1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYB5R1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYB5R1

Customers Who Bought This Also Bought