Cytochrome b5 Outer Mitochondrial Membrane Antibody

Images

 
Western Blot: Cytochrome b5 Outer Mitochondrial Membrane Antibody [NBP1-88039] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: Cytochrome b5 Outer Mitochondrial Membrane Antibody [NBP1-88039] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: Cytochrome b5 Outer Mitochondrial Membrane Antibody [NBP1-88039] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytochrome b5 Outer Mitochondrial Membrane Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYB5B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cytochrome b5 Outer Mitochondrial Membrane Protein (NBP1-88039PEP)
Publications
Read Publications using
NBP1-88039 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%). Reactivity reported in scientific literature (PMID: 22203676)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytochrome b5 Outer Mitochondrial Membrane Antibody

  • CYB5M
  • CYB5-M
  • CYPB5M
  • Cytochrome b5 outer mitochondrial membrane isoform
  • cytochrome b5 type B (outer mitochondrial membrane)
  • cytochrome b5 type B
  • DKFZp686M0619
  • OMB5
  • outer mitochondrial membrane cytochrome b5
  • type 2 cyt-b5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88985
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-02705
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-82167
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
AF1557
Species: Hu
Applications: WB
NBP1-59677
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88039
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cytochrome b5 Outer Mitochondrial Membrane Antibody (NBP1-88039)(2)

Reviews for Cytochrome b5 Outer Mitochondrial Membrane Antibody (NBP1-88039) (0)

There are no reviews for Cytochrome b5 Outer Mitochondrial Membrane Antibody (NBP1-88039). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cytochrome b5 Outer Mitochondrial Membrane Antibody (NBP1-88039) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome b5 Outer Mitochondrial Membrane Products

Bioinformatics Tool for Cytochrome b5 Outer Mitochondrial Membrane Antibody (NBP1-88039)

Discover related pathways, diseases and genes to Cytochrome b5 Outer Mitochondrial Membrane Antibody (NBP1-88039). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome b5 Outer Mitochondrial Membrane Antibody (NBP1-88039)

Discover more about diseases related to Cytochrome b5 Outer Mitochondrial Membrane Antibody (NBP1-88039).
 

Pathways for Cytochrome b5 Outer Mitochondrial Membrane Antibody (NBP1-88039)

View related products by pathway.

Blogs on Cytochrome b5 Outer Mitochondrial Membrane

There are no specific blogs for Cytochrome b5 Outer Mitochondrial Membrane, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome b5 Outer Mitochondrial Membrane Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYB5B