Cytochrome b5 Outer Mitochondrial Membrane Antibody

Western Blot: Cytochrome b5 Outer Mitochondrial Membrane Antibody [NBP1-88039] - Analysis in human cell lines A-549 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Immunocytochemistry/Immunofluorescence: Cytochrome b5 Outer Mitochondrial Membrane Antibody [NBP1-88039] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Cytochrome b5 Outer Mitochondrial Membrane Antibody [NBP1-88039] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Cytochrome b5 Outer Mitochondrial Membrane Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYB5B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 25144769). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cytochrome b5 Outer Mitochondrial Membrane Protein (NBP1-88039PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22203676), Mouse reactivity reported in scientific literature (PMID: 25144769).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cytochrome b5 Outer Mitochondrial Membrane Antibody

• CYB5M
• CYB5-M
• CYPB5M
• Cytochrome b5 outer mitochondrial membrane isoform
• cytochrome b5 type B (outer mitochondrial membrane)
• cytochrome b5 type B
• DKFZp686M0619
• OMB5
• outer mitochondrial membrane cytochrome b5
• type 2 cyt-b5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytochrome b5 Outer Mitochondrial Membrane Antibody (NBP1-88039)(3)

Publications using NBP1-88039

• Antico O, Ordureau A, Stevens M Et al. Global ubiquitylation analysis of mitochondria in primary neurons identifies endogenous Parkin targets following activation of PINK1 Science advances 2021-11-12 [PMID: 34767452] (WB, Mouse)
• Jakobs HH, Mikula M, Havemeyer A et al. The N-Reductive System Composed of Mitochondrial Amidoxime Reducing Component (mARC), Cytochrome b5 (CYB5B) and Cytochrome b5 Reductase (CYB5R) Is Regulated by Fasting and High Fat Diet in Mice. PLoS One 2014-01-01 [PMID: 25144769] (WB, Mouse)
• Neve EP, Nordling A, Andersson TB et al. Amidoxime reductase system containing cytochrome b5 type B (CYB5B) and MOSC2 is of importance for lipid synthesis in adipocyte mitochondria. J Biol Chem 2012-02-24 [PMID: 22203676]

Bioinformatics

• Gene Symbol: CYB5B