Cytochrome b5 Outer Mitochondrial Membrane Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Cytochrome b5 Outer Mitochondrial Membrane Antibody [NBP1-88039] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Analysis in human cell lines A-549 and HeLa using Anti-CYB5B antibody. Corresponding CYB5B RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.

Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Staining of human gastrointestinal shows strong granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cytochrome b5 Outer Mitochondrial Membrane Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cytochrome b5 Outer Mitochondrial Membrane Antibody - BSA Free (NBP1-88039) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Cytochrome b5 Outer Mitochondrial Membrane Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYB5B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 25144769). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cytochrome b5 Outer Mitochondrial Membrane Protein (NBP1-88039PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22203676), Mouse reactivity reported in scientific literature (PMID: 25144769).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cytochrome b5 Outer Mitochondrial Membrane Antibody - BSA Free

• CYB5M
• CYB5-M
• CYPB5M
• Cytochrome b5 outer mitochondrial membrane isoform
• cytochrome b5 type B (outer mitochondrial membrane)
• cytochrome b5 type B
• DKFZp686M0619
• OMB5
• outer mitochondrial membrane cytochrome b5
• type 2 cyt-b5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytochrome b5 Outer Mitochondrial Membrane Antibody (NBP1-88039)(3)

Publications using NBP1-88039

• Antico O, Ordureau A, Stevens M Et al. Global ubiquitylation analysis of mitochondria in primary neurons identifies endogenous Parkin targets following activation of PINK1 Science advances 2021-11-12 [PMID: 34767452] (WB, Mouse)
• Jakobs HH, Mikula M, Havemeyer A et al. The N-Reductive System Composed of Mitochondrial Amidoxime Reducing Component (mARC), Cytochrome b5 (CYB5B) and Cytochrome b5 Reductase (CYB5R) Is Regulated by Fasting and High Fat Diet in Mice. PLoS One 2014-01-01 [PMID: 25144769] (WB, Mouse)
• Neve EP, Nordling A, Andersson TB et al. Amidoxime reductase system containing cytochrome b5 type B (CYB5B) and MOSC2 is of importance for lipid synthesis in adipocyte mitochondria. J Biol Chem 2012-02-24 [PMID: 22203676]

Bioinformatics

• Gene Symbol: CYB5B