Aspartate Aminotransferase Antibody

Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778] - Titration: 1.0ug/ml, Positive Control: NCI-H226 cell lysate.

Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778] - Human Fetal Liver.

Western Blot: Aspartate Aminotransferase Antibody [NBP1-54778] - Human NCI-H226.

• Reactivity: Hu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Aspartate Aminotransferase Antibody Summary

• Description: PLEASE NOTE: 0.02mg sample size is provided in reconstituted format and the 0.1mg size is provided lyophilized. (Please see reconstitution instuctions).
• Immunogen: Synthetic peptides corresponding to GOT1(glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)) The peptide sequence was selected from the N terminal of GOT1 (NP_002070). Peptide sequence MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GOT1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
• Application Notes: This is a rabbit polyclonal antibody against GOT1 and was validated on Western blot. Use in Immunohistochemistry reported in scientific literature (PMID 27623078). Use in Immunohistochemistry-paraffin reported in scientific literature (PMID: 29375049).
• Theoretical MW: 46 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control:

  Aspartate Aminotransferase Knockout HeLa Cell Lysate

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 24611772).

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified
• Reconstitution Instructions: Centrifuge at 12,000 x g for 20 seconds. Reconstitute with 0.1 ml distilled water to a final concentration of 1.0 mg/ml in PBS buffer. Vortex followed by centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Aspartate Aminotransferase Antibody

• aspartate aminotransferase, cytoplasmic
• EC 2.6.1.1
• GIG18
• Glutamate oxaloacetate transaminase 1
• glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)
• growth-inhibiting protein 18
• Transaminase A

Background

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aspartate Aminotransferase Antibody (NBP1-54778)(8)

Publications using NBP1-54778

• Melendez-Rodriguez F, Urrutia AA, Lorendeau D et al. HIF1a Suppresses Tumor Cell Proliferation through Inhibition of Aspartate Biosynthesis Cell Rep Feb 26 2019 [PMID: 30811976] (WB, Human)
• Yang CS, Stampouloglou E, Kingston NM et al. Glutamine-utilizing transaminases are a metabolic vulnerability of TAZ/YAP-activated cancer cells. EMBO Rep. Apr 16 2018 [PMID: 29661856] (Human)
• Mohammed R, Provitera L, Cavallaro G, Lattuada D. Vasomotor effects of hydrogen sulfide in human umbilical vessels. J. Physiol. Pharmacol. 2017 Oct 01 [PMID: 29375049] (IHC-P, Human)
• Fujimura K, Wang H, Watson F, Klemke RL. KRAS oncoprotein expression is regulated by a self-governing eIF5A-PEAK1 feed-forward regulatory loop Cancer Res. 2018 Jan 10 [PMID: 29321164] (Human)
• Knudsen ES, Balaji U, Freinkman E et al. Unique metabolic features of pancreatic cancer stroma: relevance to the tumor compartment, prognosis, and invasive potential. Oncotarget. Nov 29 2016 [PMID: 27623078] (IHC, Human)
• Miyamoto Ryo, Otsuguro Ken-Ichi, Yamaguchi Soichiro, Ito Shigeo. Contribution of cysteine aminotransferase and mercaptopyruvate sulfurtransferase to hydrogen sulfide production in peripheral neurons. J Neurochem. 2014 Mar 27 [PMID: 24611772] (Rat)
• Son J, Lyssiotis CA, Ying H et al. Glutamine supports pancreatic cancer growth through a KRAS-regulated metabolic pathway Nature 2013 Apr 4 [PMID: 23535601] (WB, Human)
• Inoue,K. Diabetes Res. Clin. Pract. 79 (3), E4-E7. 2008 [PMID: 18242760]

Bioinformatics

• Gene Symbol: GOT1
• Entrez:
  • 2805(Human)
• Uniprot:
  • P17174(Human)