RDH12 Antibody (1E11) Summary
Immunogen |
RDH12 (NP_689656.1, 217 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGIRWE |
Specificity |
Reacts with retinol dehydrogenase 12 (all-trans/9-cis/11-cis). |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
RDH12 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/Immunofluorescence
- Sandwich ELISA
- Western Blot
|
Application Notes |
This antibody is reactive against recombinant protein in western blot and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RDH12 Antibody (1E11)
Background
The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3). [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, In vivo, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Publications for RDH12 Antibody (H00145226-M01) (0)
There are no publications for RDH12 Antibody (H00145226-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RDH12 Antibody (H00145226-M01) (0)
There are no reviews for RDH12 Antibody (H00145226-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RDH12 Antibody (H00145226-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RDH12 Products
Bioinformatics Tool for RDH12 Antibody (H00145226-M01)
Discover related pathways, diseases and genes to RDH12 Antibody (H00145226-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for RDH12 Antibody (H00145226-M01)
Discover more about diseases related to RDH12 Antibody (H00145226-M01).
| | Pathways for RDH12 Antibody (H00145226-M01)
View related products by pathway.
|
PTMs for RDH12 Antibody (H00145226-M01)
Learn more about PTMs related to RDH12 Antibody (H00145226-M01).
| | Research Areas for RDH12 Antibody (H00145226-M01)
Find related products by research area.
|
Blogs on RDH12