RDH12 Antibody (1E11)

Images

 
Immunocytochemistry/ Immunofluorescence: RDH12 Antibody (1E11) [H00145226-M01] - Analysis of monoclonal antibody to RDH12 on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: RDH12 Antibody (1E11) [H00145226-M01] - Detection limit for recombinant GST tagged RDH12 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1E11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RDH12 Antibody (1E11) Summary

Immunogen
RDH12 (NP_689656.1, 217 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGIRWE
Specificity
Reacts with retinol dehydrogenase 12 (all-trans/9-cis/11-cis).
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RDH12
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RDH12 Antibody (1E11)

  • All-trans and 9-cis retinol dehydrogenase
  • EC 1.1.1
  • EC 1.1.1.-
  • EC 1.1.1.100
  • FLJ30273
  • LCA13retinol dehydrogenase 12, all-trans and 9-cis
  • LCA3
  • retinol dehydrogenase 12 (all-trans and 9-cis)
  • retinol dehydrogenase 12 (all-trans/9-cis/11-cis)
  • retinol dehydrogenase 12
  • SDR7C2
  • short chain dehydrogenase/reductase family 7C, member 2

Background

The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RDH12 Antibody (H00145226-M01) (0)

There are no publications for RDH12 Antibody (H00145226-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RDH12 Antibody (H00145226-M01) (0)

There are no reviews for RDH12 Antibody (H00145226-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RDH12 Antibody (H00145226-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RDH12 Products

Research Areas for RDH12 Antibody (H00145226-M01)

Find related products by research area.

Blogs on RDH12

There are no specific blogs for RDH12, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RDH12 Antibody (1E11) and receive a gift card or discount.

Bioinformatics

Gene Symbol RDH12
Entrez
Uniprot