CXCR2/IL-8RB Antibody - BSA Free

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Analysis in human spleen and cerebral cortex tissues. Corresponding CXCR2/IL-8RB RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Staining of human cerebral cortex, colon, lymph node and spleen using Anti-CXCR2 antibody NBP2-38195 (A) shows similar protein distribution across tissues to independent antibody NBP2-38197 (B).

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Staining of human spleen shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Staining of human colon shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CXCR2/IL-8RB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CXCR2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CXCR2/IL-8RB Recombinant Protein Antigen (NBP2-38195PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CXCR2/IL-8RB Antibody - BSA Free

• CD182 antigen
• CD182
• CDw128b
• chemokine (C-X-C motif) receptor 2
• chemokine (CXC) receptor 2
• CMKAR2
• C-X-C chemokine receptor type 2
• CXCR2 gene for IL8 receptor type B
• CXCR2
• CXC-R2
• CXCR-2
• GRO/MGSA receptor
• High affinity interleukin-8 receptor B
• IL-8 RB
• IL-8 receptor type 2
• IL-8R B
• IL8R2
• IL8RA
• IL8RB
• interleukin 8 receptor B
• interleukin 8 receptor type 2
• interleukin-8 receptor type B

Background

Chemokine (Chemoattractant Cytokines) are small peptides that are potent activators and chemo-attractants for leukocyte subpopulations and other non-hemopoietic cells. Chemokine receptors (CXCR) belong to the super-family of G protein-coupled receptors (GPCR), which regulate the trafficking and activation of leukocytes, and operate as co-receptors in the entry of HIV-1 and proliferation and migration of immature neurons, glia and their precursors. Furthermore, chemokine receptors participate in the etiology and progression of various brain disorders, including AIDS dementia, neuro-inflammatory disease and neuroplasia, making them important potential therapeutic targets in these cases several subtypes of CXCR have been characterized. Activation of na

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CXCR2
• Uniprot:
  • P25025(Human)