CXCL9/MIG Antibody (1F5)

Images

 
Sandwich ELISA: CXCL9/MIG Antibody (1F5) [H00004283-M06] - Detection limit for recombinant GST tagged CXCL9 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
1F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CXCL9/MIG Antibody (1F5) Summary

Immunogen
CXCL9 (AAH63122, 23 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Specificity
CXCL9 - chemokine (C-X-C motif) ligand 9 (1F5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CXCL9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCL9/MIG Antibody (1F5)

  • chemokine (C-X-C motif) ligand 9
  • CMK
  • crg-10
  • C-X-C motif chemokine 9
  • CXCL9
  • Gamma-interferon-induced monokine
  • Humig
  • MIG
  • MIGSmall-inducible cytokine B9
  • monokine induced by gamma interferon
  • SCYB9Monokine induced by interferon-gamma

Background

The function of this gene has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DIP100
Species: Hu
Applications: ELISA
DCX110
Species: Hu
Applications: ELISA
MAB160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
285-IF
Species: Hu
Applications: BA
DCP00
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
DRN00B
Species: Hu
Applications: ELISA
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MCC170
Species: Mu
Applications: ELISA
MME00
Species: Mu
Applications: ELISA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
DMD00
Species: Hu
Applications: ELISA
MMA00
Species: Mu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
DY453
Species: Mu
Applications: ELISA
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut

Publications for CXCL9/MIG Antibody (H00004283-M06) (0)

There are no publications for CXCL9/MIG Antibody (H00004283-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCL9/MIG Antibody (H00004283-M06) (0)

There are no reviews for CXCL9/MIG Antibody (H00004283-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CXCL9/MIG Antibody (H00004283-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCL9/MIG Products

Bioinformatics Tool for CXCL9/MIG Antibody (H00004283-M06)

Discover related pathways, diseases and genes to CXCL9/MIG Antibody (H00004283-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL9/MIG Antibody (H00004283-M06)

Discover more about diseases related to CXCL9/MIG Antibody (H00004283-M06).
 

Pathways for CXCL9/MIG Antibody (H00004283-M06)

View related products by pathway.

PTMs for CXCL9/MIG Antibody (H00004283-M06)

Learn more about PTMs related to CXCL9/MIG Antibody (H00004283-M06).
 

Research Areas for CXCL9/MIG Antibody (H00004283-M06)

Find related products by research area.

Blogs on CXCL9/MIG

There are no specific blogs for CXCL9/MIG, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCL9/MIG Antibody (1F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCL9
Entrez
Uniprot