CXCL7/NAP-2 Antibody

Images

 
Western Blot: NAP2 Antibody [NBP1-89921] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: NAP2 Antibody [NBP1-89921] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes of bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXCL7/NAP-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CXCL7/NAP-2 Protein (NBP1-89921PEP)
Publications
Read Publication using NBP1-89921.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXCL7/NAP-2 Antibody

  • Beta-TG
  • connective tissue-activating peptide III
  • CTAP III
  • CTAP3CTAP-III
  • CTAPIII
  • CXC chemokine ligand 7
  • C-X-C motif chemokine 7
  • CXCL7
  • CXCL7b-TG1
  • LA-PF4
  • LDGFTC1
  • Leukocyte-derived growth factor
  • low-affinity platelet factor IV
  • Macrophage-derived growth factor
  • MDGFTC2
  • NAP2
  • NAP-2
  • NAP-2-L1
  • neutrophil-activating peptide 2
  • neutrophil-activating peptide-2
  • PBPTHBGB
  • platelet basic protein
  • PPBP
  • pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
  • SCAR10
  • SCYB7beta-thromboglobulin
  • small inducible cytokine B7
  • small inducible cytokine subfamily B, member 7
  • Small-inducible cytokine B7
  • TGB
  • TGB1B-TG1
  • THBGB1
  • thrombocidin 1
  • thrombocidin 2
  • thromboglobulin, beta-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

795-P4/CF
Species: Hu
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB331
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-89921
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CXCL7/NAP-2 Antibody (NBP1-89921)(1)

Reviews for CXCL7/NAP-2 Antibody (NBP1-89921) (0)

There are no reviews for CXCL7/NAP-2 Antibody (NBP1-89921). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCL7/NAP-2 Antibody (NBP1-89921) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCL7/NAP-2 Products

Bioinformatics Tool for CXCL7/NAP-2 Antibody (NBP1-89921)

Discover related pathways, diseases and genes to CXCL7/NAP-2 Antibody (NBP1-89921). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL7/NAP-2 Antibody (NBP1-89921)

Discover more about diseases related to CXCL7/NAP-2 Antibody (NBP1-89921).
 

Pathways for CXCL7/NAP-2 Antibody (NBP1-89921)

View related products by pathway.

PTMs for CXCL7/NAP-2 Antibody (NBP1-89921)

Learn more about PTMs related to CXCL7/NAP-2 Antibody (NBP1-89921).
 

Research Areas for CXCL7/NAP-2 Antibody (NBP1-89921)

Find related products by research area.

Blogs on CXCL7/NAP-2

There are no specific blogs for CXCL7/NAP-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCL7/NAP-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPBP
Entrez