CXCL4/PF4 Antibody (6Q10H2)

Western Blot: CXCL4/PF4 Antibody (6Q10H2) [NBP3-16251] - Western blot analysis of extracts of various cell lines, using CXCL4/CXCL4/PF4 Rabbit mAb (NBP3-16251) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry-Paraffin: CXCL4/PF4 Antibody (6Q10H2) [NBP3-16251] - Immunohistochemistry of paraffin-embedded rat lung using CXCL4/CXCL4/PF4 Rabbit mAb (NBP3-16251) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: CXCL4/PF4 Antibody (6Q10H2) [NBP3-16251] - Immunohistochemistry of paraffin-embedded mouse bone marrow using CXCL4/CXCL4/PF4 Rabbit mAb (NBP3-16251) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: CXCL4/PF4 Antibody (6Q10H2) [NBP3-16251] - Confocal imaging of Mouse leg bone using CXCL4/PF4 Rabbit mAb. DAPI was used for nuclear staining (blue). Objective: 40x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 6Q10H2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CXCL4/PF4 Antibody (6Q10H2) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-101 of human CXCL4/CXCL4/PF4 (P02776). MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:1000
  • Immunohistochemistry 1:100 - 1:1000
  • Immunohistochemistry-Paraffin 1:100 - 1:1000
  • Western Blot 1:1000 - 1:4000
• Theoretical MW: 11 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CXCL4/PF4 Antibody (6Q10H2)

• chemokine (C-X-C motif) ligand 4
• C-X-C motif chemokine 4
• CXCL4
• CXCL4iroplact
• Iroplact
• MGC138298
• Oncostatin-A
• PF4
• PF-4
• platelet factor 4
• SCYB4oncostatin-A

Background

Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair (Eisman et al., 1990 [PubMed 1695112]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CXCL4/PF4 Antibody (NBP3-16251)(2)

Publications using NBP3-16251

• Drelich A, Rayavara K, Hsu J et al. Characterization of Unique Pathological Features of COVID-Associated Coagulopathy: Studies with AC70 hACE2 Transgenic Mice Highly Permissive to SARS-CoV-2 Infection bioRxiv 2023-10-31
• Aleksandra K. Drelich, Kempaiah Rayavara, Jason Hsu, Panatda Saenkham-Huntsinger, Barbara M. Judy, Vivian Tat, Thomas G. Ksiazek, Bi-Hung Peng, Chien-Te K. Tseng, Julie Fox Characterization of Unique Pathological Features of COVID-Associated Coagulopathy: Studies with AC70 hACE2 Transgenic Mice Highly Permissive to SARS-CoV-2 Infection PLOS Pathogens 2024-06-24 [PMID: 38913740]

Bioinformatics

• Gene Symbol: PF4