CTGF/CCN2 Antibody - BSA Free

Western Blot: CTGF/CCN2 Antibody [NBP1-86571] - Analysis in human cell line EFO-21.

Immunocytochemistry/Immunofluorescence: CTGF/CCN2 Antibody [NBP1-86571] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571] - Staining of human endometrium shows moderate to strong secreted positivity.

Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571] - Staining of human stomach, upper shows moderate positivity in plasma and stromal cells.

Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571] - Staining of human placenta shows moderate to strong cytoplasmic positivity in vascular endothelial cells.

Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571] - Staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CTGF/CCN2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CTGF/CCN2 Protein (NBP1-86571PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CTGF/CCN2 Antibody - BSA Free

• CCN2
• CCN2IGFBP-8
• connective tissue growth factor
• CTGF
• CTGRP
• Fisp12
• HCS24
• Hypertrophic chondrocyte-specific protein 24
• IBP-8
• IGF-binding protein 8
• IGFBP-8
• IGFBP8CCN family member 2
• Insulin-like growth factor-binding protein 8
• MGC102839
• NOV2

Background

Connective Tissue Growth Factor (CTGF) is a 38kDa, cysteine-rich, secreted peptide. CTGF promotes endothelial cell growth, migration, adhesion and survival. and is thus implicated in endothelial cell function and angiogenesis. CTGF is implicated in are embryogenesis, wound healing and regulation of extracellular matrix production, and is required for normal skeletal growth.

CTGF antibodies are useful tools for angiogenesis and cell structure research, and for studies on certian types of cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for CTGF/CCN2 Antibody (NBP1-86571). (Showing 1 - 1 of 1 FAQ).

1. We are looking for a pair of mouse CTGF antibody for ELISA, we prefer no azide and/or glycerol, and in carrier free form (no EDTA, no Tris, no BSA). For the validation, we need approximately 100ug. If it works, we'll order more later.
   • Unfortunately we do not carry any CTGF antibodies that suit your specifications. We do carry AbSelect antibody purification kits that will remove BSA, Tris and azide from antibody formulations which may be an option for you.

Bioinformatics

• Gene Symbol: CCN2