CTGF/CCN2 Antibody

Images

 
Western Blot: CTGF/CCN2 Antibody [NBP1-86571] - Analysis in human cell line EFO-21.
Immunocytochemistry/ Immunofluorescence: CTGF/CCN2 Antibody [NBP1-86571] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571] - Staining of human stomach, upper shows moderate positivity in plasma and stromal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CTGF/CCN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTGF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CTGF/CCN2 Protein (NBP1-86571PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CTGF/CCN2 Antibody

  • CCN2
  • CCN2IGFBP-8
  • connective tissue growth factor
  • CTGF
  • CTGRP
  • Fisp12
  • HCS24
  • Hypertrophic chondrocyte-specific protein 24
  • IBP-8
  • IGF-binding protein 8
  • IGFBP-8
  • IGFBP8CCN family member 2
  • Insulin-like growth factor-binding protein 8
  • MGC102839
  • NOV2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-356
Species: Hu, Rb
Applications: WB, Simple Western, B/N, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for CTGF/CCN2 Antibody (NBP1-86571) (0)

There are no publications for CTGF/CCN2 Antibody (NBP1-86571).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTGF/CCN2 Antibody (NBP1-86571) (0)

There are no reviews for CTGF/CCN2 Antibody (NBP1-86571). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CTGF/CCN2 Antibody (NBP1-86571). (Showing 1 - 1 of 1 FAQ).

  1. We are looking for a pair of mouse CTGF antibody for ELISA, we prefer no azide and/or glycerol, and in carrier free form (no EDTA, no Tris, no BSA). For the validation, we need approximately 100ug. If it works, we'll order more later.
    • Unfortunately we do not carry any CTGF antibodies that suit your specifications. We do carry AbSelect antibody purification kits that will remove BSA, Tris and azide from antibody formulations which may be an option for you.

Secondary Antibodies

 

Isotype Controls

Additional CTGF/CCN2 Products

Bioinformatics Tool for CTGF/CCN2 Antibody (NBP1-86571)

Discover related pathways, diseases and genes to CTGF/CCN2 Antibody (NBP1-86571). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTGF/CCN2 Antibody (NBP1-86571)

Discover more about diseases related to CTGF/CCN2 Antibody (NBP1-86571).
 

Pathways for CTGF/CCN2 Antibody (NBP1-86571)

View related products by pathway.

PTMs for CTGF/CCN2 Antibody (NBP1-86571)

Learn more about PTMs related to CTGF/CCN2 Antibody (NBP1-86571).
 

Research Areas for CTGF/CCN2 Antibody (NBP1-86571)

Find related products by research area.

Blogs on CTGF/CCN2

There are no specific blogs for CTGF/CCN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTGF/CCN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTGF
Entrez