CTGF/CCN2 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG |
Predicted Species |
Mouse (96%), Rat (97%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CCN2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:10-1:20
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for CTGF/CCN2 Antibody - BSA Free
Background
Connective Tissue Growth Factor (CTGF) is a 38kDa, cysteine-rich, secreted peptide. CTGF promotes endothelial cell growth, migration, adhesion and survival. and is thus implicated in endothelial cell function and angiogenesis. CTGF is implicated in are embryogenesis, wound healing and regulation of extracellular matrix production, and is required for normal skeletal growth.
CTGF antibodies are useful tools for angiogenesis and cell structure research, and for studies on certian types of cancer.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Publications for CTGF/CCN2 Antibody (NBP1-86571) (0)
There are no publications for CTGF/CCN2 Antibody (NBP1-86571).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CTGF/CCN2 Antibody (NBP1-86571) (0)
There are no reviews for CTGF/CCN2 Antibody (NBP1-86571).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CTGF/CCN2 Antibody (NBP1-86571). (Showing 1 - 1 of 1 FAQ).
-
We are looking for a pair of mouse CTGF antibody for ELISA, we prefer no azide and/or glycerol, and in carrier free form (no EDTA, no Tris, no BSA). For the validation, we need approximately 100ug. If it works, we'll order more later.
- Unfortunately we do not carry any CTGF antibodies that suit your specifications. We do carry AbSelect antibody purification kits that will remove BSA, Tris and azide from antibody formulations which may be an option for you.
Secondary Antibodies
| |
Isotype Controls
|
Additional CTGF/CCN2 Products
Research Areas for CTGF/CCN2 Antibody (NBP1-86571)
Find related products by research area.
|
Blogs on CTGF/CCN2