CS Citrate Synthase Antibody

Images

 
Western Blot: CS Citrate Synthase Antibody [NBP2-13878] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunocytochemistry/ Immunofluorescence: CS Citrate Synthase Antibody [NBP2-13878] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CS Citrate Synthase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDP DEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
CS Citrate Synthase Recombinant Protein Antigen (NBP2-13878PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CS Citrate Synthase Antibody

  • citrate synthase
  • citrate synthase, mitochondrial
  • EC 2.3.3
  • EC 2.3.3.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003033-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13878
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CS Citrate Synthase Antibody (NBP2-13878) (0)

There are no publications for CS Citrate Synthase Antibody (NBP2-13878).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CS Citrate Synthase Antibody (NBP2-13878) (0)

There are no reviews for CS Citrate Synthase Antibody (NBP2-13878). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CS Citrate Synthase Antibody (NBP2-13878) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CS Citrate Synthase Products

Bioinformatics Tool for CS Citrate Synthase Antibody (NBP2-13878)

Discover related pathways, diseases and genes to CS Citrate Synthase Antibody (NBP2-13878). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CS Citrate Synthase Antibody (NBP2-13878)

Discover more about diseases related to CS Citrate Synthase Antibody (NBP2-13878).
 

Pathways for CS Citrate Synthase Antibody (NBP2-13878)

View related products by pathway.

PTMs for CS Citrate Synthase Antibody (NBP2-13878)

Learn more about PTMs related to CS Citrate Synthase Antibody (NBP2-13878).

Blogs on CS Citrate Synthase

There are no specific blogs for CS Citrate Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CS Citrate Synthase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CS