| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 964-1064 of human CRM1 (NP_003391.1). Sequence: PGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | XPO1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 123 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CRM1 Antibody (NBP3-35072)Find related products by research area.
|
|
Survivin Acetylation: Affecting Apoptosis and Cancer Survivin (BRIC5) is an inhibitor of apoptosis that also promotes cellular adaptation under stressful conditions and helps to regulate cell division. Recently, an antibody study by Dr. H Wang et al. at Brown University [PMID: 20826784] found that Survi... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | XPO1 |