CRM1 Antibody (1J0L10)

Western Blot: CRM1 Antibody (1J0L10) [NBP3-15823] - Western blot analysis of extracts of various cell lines, using CRM1 antibody (NBP3-15823) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Western Blot: CRM1 Antibody (1J0L10) [NBP3-15823] - Western blot analysis of extracts of mouse lung, using CRM1 antibody (NBP3-15823) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/Immunofluorescence: CRM1 Antibody (1J0L10) [NBP3-15823] - Immunofluorescence analysis of NIH-3T3 cells using CRM1 antibody (NBP3-15823). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: CRM1 Antibody (1J0L10) [NBP3-15823] - Immunofluorescence analysis of HeLa cells using CRM1 antibody (NBP3-15823). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: CRM1 Antibody (1J0L10) [CRM1] - Immunofluorescence analysis of C6 cells using CRM1 Rabbit mAb . Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 1J0L10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CRM1 Antibody (1J0L10) Summary

• Description: Novus Biologicals Rabbit CRM1 Antibody (1J0L10) (NBP3-15823) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 972-1071 of human CRM1 (O14980). IFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: XPO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CRM1 Antibody (1J0L10)

• Chromosome region maintenance 1 protein homolog
• DKFZp686B1823
• emb
• exp1
• exportin 1 (CRM1 homolog, yeast)
• exportin 1 (CRM1, yeast, homolog)
• Exportin-1 (required for chromosome region maintenance)
• exportin-1
• yeast, homolog

Background

Official Gene Symbol: XPO1 Gen Bank Accession Number: NP_003391 Gene ID: 7514 (human) Gene Map Locus: 2p16 (human) Nuclear transport receptors of karyopherin/importin-beta superfamily mediate various transport pathways between nucleus and cytoplasm. Exportin-1, a human homolog of yeast CRM1, is a novel karyopherin export receptor that mediates leucine-rich NES-dependent protein export. It interacts with RanGTP through its Ran-binding domain and also with nucleoporins including Nup214, Nup50, Nup42 and Nup159 during the process of exporting NES-containing proteins. It mediates the export of many cellular and viral proteins and ribonucleoproteins including HIV Rev Protein, ERK3, PKI, IRF-5, Cyclin-B, MAPKK, MAPKAP kinase 2, Snurportin, Cap-binding protein, and certain U snRNAs. Reports suggest exportin-1 also has a role in the regulation of NFAT and AP-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XPO1