CRBN Antibody

Images

 
Genetic Strategies: Western Blot: CRBN Antibody [NBP1-91810] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: CRBN Antibody [NBP1-91810] - Staining of human cell line U-251 MG shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CRBN Antibody [NBP1-91810] - Staining of human skeletal muscle shows only weak cytoplasmic positivity in striated muscle fibers.
Western Blot: CRBN Antibody [NBP1-91810] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: CRBN Antibody [NBP1-91810] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CRBN Antibody [NBP1-91810] - Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: CRBN Antibody [NBP1-91810] - Staining of human colon shows moderate cytoplasmic and nuclear positivity in peripheral ganglion.
Simple Western: CRBN Antibody [NBP1-91810] - Simple Western lane view shows a specific band for CRBN in 0.2 mg/ml of RT4 (left), U-251MG (right) lysate. This experiment was performed under reducing conditions using ...read more
Simple Western: CRBN Antibody [NBP1-91810] - Electropherogram image(s) of corresponding Simple Western lane view. CRBN antibody was used at 1:60 dilution on RT4 and U-251MG lysate(s).
Genetic Strategies: Single Cell Western: CRBN Antibody [NBP1-91810] - CRBN expression after Downregulation by siRNA, dilution 1:500. Single Cell Western Image submitted by verified customer review.
Knockdown Validated: CRBN Antibody [NBP1-91810] - Validation of SALL4 asa bona fide IMiD-dependent CRL4CRBN substrate. Parental Kelly cells or two independent pools of CRBN -/- Kelly cells were treated with increasing ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD, KO, Single-Cell Western
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

CRBN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRBN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Knockout Validated
  • Simple Western 1:60
  • Single Cell Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. Knockout validation (PMID: 31371704).
Control Peptide
CRBN Protein (NBP1-91810PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-91810 in the following applications:

Publications
Read Publications using
NBP1-91810 in the following applications:

  • KO
    1 publication
  • SW
    1 publication
  • WB
    12 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24206017)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRBN Antibody

  • Cereblon
  • CRBN
  • DKFZp781K0715
  • MGC27358
  • MRT2
  • MRT2A
  • non-syndromic, autosomal recessive, 2A
  • protein cereblon
  • Protein X 0001

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-87781
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-33061
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-76784
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF5525
Species: Hu
Applications: IHC, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP2-75459
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF5495
Species: Mu
Applications: IHC, WB
H00001663-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
MAB3765
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP2-76827
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00001831-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-24569
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm, Rt, Xp, Ze
Applications: IHC, IHC-P, Simple Western, WB
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB500-255
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00006452-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-91810
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD, KO, Single-Cell Western

Publications for CRBN Antibody (NBP1-91810)(17)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: KO, SW, WB.


Filter By Application
KO
(1)
SW
(1)
WB
(12)
All Applications
Filter By Species
Human
(11)
All Species
Showing Publications 1 - 10 of 17. Show All 17 Publications.
Publications using NBP1-91810 Applications Species
Yamamoto T, Nakayama J, Yamamoto Y et al. SORT1/LAMP2-mediated Extracellular Vesicle Secretion and Cell Adhesion Are Linked to Lenalidomide Resistance in Multiple Myeloma Blood advances Jan 3 2022 [PMID: 34979567] (WB) WB
Mori T, Verma R, Nakamoto-Matsubara R et al. Low NCOR2 levels in multiple myeloma patients drive multidrug resistance via MYC upregulation Blood cancer journal Dec 4 2021 [PMID: 34864816] (WB, Human) WB Human
Shen C, Nayak A, Neitzel LR et al. The E3 ubiquitin ligase component, Cereblon, is an evolutionarily conserved regulator of Wnt signaling Nature communications Sep 6 2021 [PMID: 34489457] (WB, Human) WB Human
Powell C, Du G, Bushman J Et Al. Selective degradation-inducing probes for studying cereblon (CRBN) biology RSC Medicinal Chemistry Jul 6 2021 [PMID: 34458741]
Misiewicz-Krzeminska, I, de Ramon, C Et al. Quantitative expression of Ikaros, IRF4, and PSMD10 proteins predicts survival in VRD-treated patients with multiple myeloma. Blood Adv Dec 8 2020 [PMID: 33284947] (SW, Human) SW Human
Powell CE, Du G, Che J et al. Selective Degradation of GSPT1 by Cereblon Modulators Identified via a Focused Combinatorial Library ACS Chem. Biol. Sep 28 2020 [PMID: 32865967]
Wu X, Yang X, Xiong Y et al. Distinct CDK6 complexes determine tumor cell response to CDK4/6 inhibitors and degraders Nature Cancer Mar 1 2021 (WB, Human) WB Human
Martinez-Hoyer S, Deng Y, Parker J et al. Loss of lenalidomide-induced megakaryocytic differentiation leads to therapy resistance in del(5q) myelodysplastic syndrome Nat. Cell Biol. Apr 6 2020 [PMID: 32251398]
de Wispelaere M, Du G, Donovan KA et al. Small molecule degraders of the hepatitis C virus protease reduce susceptibility to resistance mutations Nat Commun Aug 1 2019 [PMID: 31371704] (KO, WB, Human) KO, WB Human
Girardini M, Maniaci C, Hughes SJ et al. Cereblon versus VHL: Hijacking E3 ligases against each other using PROTACs Bioorg. Med. Chem. Feb 22 2019 [PMID: 30826187] (WB, Human) WB Human
Show All 17 Publications.

Review for CRBN Antibody (NBP1-91810) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-91810:
Filter by Applications
In Cell Western
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Other CRBN NBP1-91810
Enlarge
4
reviewed by:
Ingrid MONTARRAS
In Cell Western Human 11/14/2019
View

Summary

ApplicationOther
Sample TestedCancer Cells
SpeciesHuman
LotBD11702

Comments

Comments1/500 dilution

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CRBN Antibody (NBP1-91810). (Showing 1 - 1 of 1 FAQs).

  1. For the picture on your website, you run four cell lines. The lane 2 and 3 all have two bands. Which is the CRBN?
    • Human CRBN has two known isoforms, both of which are approximately the same molecular weight, 50kDa. Given this information, it would be extremely difficult to distinguish the two in a WB. In our testing of the two cell lines, we did get multiple bands very close to each other, while in other lines or tissue lysates, we get one clean band. Unfortunately, we have not yet fully investigated the multiple banding pattern shown in the image. The antibody is polyclonal, so we typically tend to see some non-specific banding that can be cleaned up with further protocol optimization.

Secondary Antibodies

 

Isotype Controls

Additional CRBN Products

Bioinformatics Tool for CRBN Antibody (NBP1-91810)

Discover related pathways, diseases and genes to CRBN Antibody (NBP1-91810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRBN Antibody (NBP1-91810)

Discover more about diseases related to CRBN Antibody (NBP1-91810).
 

Pathways for CRBN Antibody (NBP1-91810)

View related products by pathway.

PTMs for CRBN Antibody (NBP1-91810)

Learn more about PTMs related to CRBN Antibody (NBP1-91810).
 

Research Areas for CRBN Antibody (NBP1-91810)

Find related products by research area.

Blogs on CRBN

There are no specific blogs for CRBN, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Ingrid MONTARRAS
11/14/2019
Application: In Cell Western
Species: Human

Bioinformatics

Gene Symbol CRBN
Entrez
Uniprot