CRBN Antibody

Western Blot: CRBN Antibody [NBP1-91810] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: CRBN Antibody [NBP1-91810] - Staining of human cell line U-251 MG shows localization to nucleoli. Antibody staining is shown in green.

Western Blot: CRBN Antibody [NBP1-91810] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Simple Western: CRBN Antibody [NBP1-91810] - Simple Western lane view shows a specific band for CRBN in 0.2 mg/ml of RT4 (left), U-251MG (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: CRBN Antibody [NBP1-91810] - Electropherogram image(s) of corresponding Simple Western lane view. CRBN antibody was used at 1:60 dilution on RT4 and U-251MG lysate(s).

Single Cell Western: CRBN Antibody [NBP1-91810] - CRBN expression after Downregulation by siRNA, dilution 1:500. Single Cell Western Image submitted by verified customer review.

Knockdown Validated: CRBN Antibody [NBP1-91810] - Validation of SALL4 asa bona fide IMiD-dependent CRL4CRBN substrate. Parental Kelly cells or two independent pools of CRBN -/- Kelly cells were treated with increasing concentrations of thalidomide. Following 24 h incubation, SALL4, CRBN, and GAPDH protein levels were assessed by western blot analysis. Thalidomide promotes degradation of SALL4, a transcription factor implicated in Duane Radial Ray syndrome. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30067223/) licensed under a CC-BY license.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, KD, KO, Single-Cell Western
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CRBN Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRBN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
  • Knockout Validated Validation (PMID: 31371704).
  • Simple Western 1:60
  • Single Cell Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  CRBN Protein (NBP1-91810PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24206017)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CRBN Antibody

• Cereblon
• CRBN
• DKFZp781K0715
• MGC27358
• MRT2
• MRT2A
• non-syndromic, autosomal recessive, 2A
• protein cereblon
• Protein X 0001

Background

Modulates cell surface expression of KCNT1 . May be involved in memory and learning

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CRBN Antibody (NBP1-91810)(20)

Publications using NBP1-91810

• Jiang B, Weinstock DM, Donovan KA et al. ITK degradation to block T cell receptor signaling and overcome therapeutic resistance in T cell lymphomas Cell chemical biology 2023-04-20 [PMID: 37015223] (WB, Mouse)
• Mehta S, Buyanbat A, Kai Y et al. Temporal resolution of gene derepression and proteome changes upon PROTAC-mediated degradation of BCL11A protein in erythroid cells Cell chemical biology 2022-07-12 [PMID: 35839780] (WB, Human)
• Shen C, Nayak A, Neitzel L et al. The Casein kinase 1alpha agonist pyrvinium attenuates Wnt-mediated CK1alpha degradation via interaction with the E3 ubiquitin ligase component Cereblon Journal of Biological Chemistry 2022-07-01 [PMID: 35780831] (WB, Human)
• Yamamoto T, Nakayama J, Yamamoto Y et al. SORT1/LAMP2-mediated Extracellular Vesicle Secretion and Cell Adhesion Are Linked to Lenalidomide Resistance in Multiple Myeloma Blood advances 2022-01-03 [PMID: 34979567] (WB)
• Mori T, Verma R, Nakamoto-Matsubara R et al. Low NCOR2 levels in multiple myeloma patients drive multidrug resistance via MYC upregulation Blood cancer journal 2021-12-04 [PMID: 34864816] (WB, Human)
• Wu X, Yang X, Xiong Y et al. Distinct CDK6 complexes determine tumor cell response to CDK4/6 inhibitors and degraders Nat Cancer 2021-09-27 [PMID: 34568836]
• Shen C, Nayak A, Neitzel LR et al. The E3 ubiquitin ligase component, Cereblon, is an evolutionarily conserved regulator of Wnt signaling Nature communications 2021-09-06 [PMID: 34489457] (WB, Human)
• Powell C, Du G, Bushman J Et Al. Selective degradation-inducing probes for studying cereblon (CRBN) biology RSC Medicinal Chemistry 2021-07-06 [PMID: 34458741]
• Misiewicz-Krzeminska, I, de Ramon, C Et al. Quantitative expression of Ikaros, IRF4, and PSMD10 proteins predicts survival in VRD-treated patients with multiple myeloma. Blood Adv 2020-12-08 [PMID: 33284947] (SW, Human)
• Powell CE, Du G, Che J et al. Selective Degradation of GSPT1 by Cereblon Modulators Identified via a Focused Combinatorial Library ACS Chem. Biol. 2020-09-28 [PMID: 32865967]
• Martinez-Hoyer S, Deng Y, Parker J et al. Loss of lenalidomide-induced megakaryocytic differentiation leads to therapy resistance in del(5q) myelodysplastic syndrome Nat. Cell Biol. 2020-04-06 [PMID: 32251398]
• de Wispelaere M, Du G, Donovan KA et al. Small molecule degraders of the hepatitis C virus protease reduce susceptibility to resistance mutations Nat Commun 2019-08-01 [PMID: 31371704] (WB, KO, Human)
• Girardini M, Maniaci C, Hughes SJ et al. Cereblon versus VHL: Hijacking E3 ligases against each other using PROTACs Bioorg. Med. Chem. 2019-02-22 [PMID: 30826187] (WB, Human)
• Zoppi V, Hughes SJ, Maniaci C et al. Iterative design and optimization of initially inactive Proteolysis Targeting Chimeras (PROTACs) identify VZ185 as a potent, fast and selective von Hippel-Lindau (VHL)-based dual degrader probe of BRD9 and BRD7 J. Med. Chem. 2018-12-12 [PMID: 30540463] (WB, Human)
• Sievers Q L, Petzold G et al. Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN. Science 2018-02-11 [PMID: 30385546] (WB, Human)
• Donovan KA, An J, Nowak RP et al. Thalidomide promotes degradation of SALL4, a transcription factor implicated in Duane Radial Ray syndrome. Elife 2018-08-01 [PMID: 30067223] (WB, Human)
• Olson CM, Jiang B, Erb MA et al. Pharmacological perturbation of CDK9 using selective CDK9 inhibition or degradation Nat. Chem. Biol. [PMID: 29251720] (WB, Human)
• Huang HT, Dobrovolsky D, Paulk J et al. A Chemoproteomic Approach to Query the Degradable Kinome Using a Multi-kinase Degrader Cell Chem Biol. 2017-11-07 [PMID: 29129717] (WB)
• An J, Ponthier CM, Sack R et al. pSILAC mass spectrometry reveals ZFP91 as IMiD-dependent substrate of the CRL4(CRBN) ubiquitin ligase Nat Commun 2017-05-22 [PMID: 28530236] (Human)
• Gandhi AK, Mendy D, Waldman M et al. Measuring cereblon as a biomarker of response or resistance to lenalidomide and pomalidomide requires use of standardized reagents and understanding of gene complexity. Br J Haematol 2014-01-01 [PMID: 24206017] (WB)

Review for CRBN Antibody (NBP1-91810) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Ingrid MONTARRAS In Cell Western Human 11/14/2019

Summary

• Application: Other
• Sample Tested: Cancer Cells
• Species: Human
• Lot: BD11702

Comments

• Comments: 1/500 dilution

FAQs for CRBN Antibody (NBP1-91810). (Showing 1 - 1 of 1 FAQs).

1. For the picture on your website, you run four cell lines. The lane 2 and 3 all have two bands. Which is the CRBN?
   • Human CRBN has two known isoforms, both of which are approximately the same molecular weight, 50kDa. Given this information, it would be extremely difficult to distinguish the two in a WB. In our testing of the two cell lines, we did get multiple bands very close to each other, while in other lines or tissue lysates, we get one clean band. Unfortunately, we have not yet fully investigated the multiple banding pattern shown in the image. The antibody is polyclonal, so we typically tend to see some non-specific banding that can be cleaned up with further protocol optimization.

Bioinformatics

• Gene Symbol: CRBN
• Entrez:
  • 51185(Human)
• Uniprot:
  • Q96SW2()