GilZ Antibody (3A5)

Images

 
Western Blot: GilZ Antibody (3A5) [H00001831-M01] - Analysis of TSC22D3 expression in transfected 293T cell line by TSC22D3 monoclonal antibody (M01), clone 3A5.Lane 1: TSC22D3 transfected lysate(22.2 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: GilZ Antibody (3A5) [H00001831-M01] - Analysis of monoclonal antibody to TSC22D3 on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: GilZ Antibody (3A5) [H00001831-M01] - Human lymph node. Antigen retrieval in citrate buffer at 95C for 30 min. Image from verified customer review.
Immunohistochemistry-Paraffin: GilZ Antibody (3A5) [H00001831-M01] - Analysis of monoclonal antibody to TSC22D3 on formalin-fixed paraffin-embedded human lymph node. Antibody concentration 3 ug/ml.
Immunoprecipitation: GilZ Antibody (3A5) [H00001831-M01] - Analysis of TSC22D3 transfected lysate using anti-TSC22D3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TSC22D3 MaxPab rabbit ...read more
ELISA: GilZ Antibody (3A5) [H00001831-M01] - Detection limit for recombinant GST tagged TSC22D3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP
Clone
3A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GilZ Antibody (3A5) Summary

Immunogen
TSC22D3 (NP_932174, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT
Specificity
TSC22D3 - TSC22 domain family, member 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TSC22D3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 10 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 3 ug/ml
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P, IF and ELISA.
Reviewed Applications
Read 1 Review rated 4
using
H00001831-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GilZ Antibody (3A5)

  • Delta sleep-inducing peptide immunoreactor
  • DSIP-immunoreactive leucine zipper protein
  • DSIP-immunoreactive peptide
  • GILZDKFZp313A1123
  • Glucocorticoid-induced leucine zipper protein
  • Protein DIP
  • TSC22 domain family protein 3
  • TSC22 domain family, member 3
  • TSC-22 related protein
  • TSC-22-like protein
  • TSC-22-related protein
  • TSC-22Rimmunoreactor

Background

The protein encoded by this gene shares significant sequence identity with the murine TSC-22 and Drosophila shs, both of which are leucine zipper proteins, that function as transcriptional regulators. The expression of this gene is stimulated by glucocorticoids and interleukin 10, and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid and chemokine. Transcript variants encoding different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
AF2005
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-90214
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-76932
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
664-LI/CF
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
202-IL
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NBP2-41211
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-57531
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87581
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86856
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB300-119
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00001831-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for GilZ Antibody (H00001831-M01) (0)

There are no publications for GilZ Antibody (H00001831-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for GilZ Antibody (H00001831-M01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00001831-M01:
Filter by Applications
Immunohistochemistry-Paraffin
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin GilZ H00001831-M01
Enlarge
4
reviewed by:
Verified Customer
Immunohistochemistry-Paraffin Human 09/25/2018
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedLymph node
SpeciesHuman
LotHC181-3A5

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GilZ Antibody (H00001831-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GilZ Products

Bioinformatics Tool for GilZ Antibody (H00001831-M01)

Discover related pathways, diseases and genes to GilZ Antibody (H00001831-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GilZ Antibody (H00001831-M01)

Discover more about diseases related to GilZ Antibody (H00001831-M01).
 

Pathways for GilZ Antibody (H00001831-M01)

View related products by pathway.

PTMs for GilZ Antibody (H00001831-M01)

Learn more about PTMs related to GilZ Antibody (H00001831-M01).
 

Research Areas for GilZ Antibody (H00001831-M01)

Find related products by research area.

Blogs on GilZ

There are no specific blogs for GilZ, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
09/25/2018
Application: Immunohistochemistry-Paraffin
Species: Human

Bioinformatics

Gene Symbol TSC22D3
Entrez
OMIM
Uniprot