COMT Antibody

Images

 
Orthogonal Strategies: Western Blot: COMT Antibody [NBP1-85818] - Analysis in human cell lines MCF-7 and PC-3 using Anti-COMT antibody. Corresponding COMT RNA-seq data are presented for the same cell lines. ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: COMT Antibody [NBP1-85818] - Staining in human placenta and pancreas tissues using anti-COMT antibody. Corresponding COMT RNA-seq data are presented for the ...read more
Western Blot: COMT Antibody [NBP1-85818] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: COMT Antibody [NBP1-85818] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: COMT Antibody [NBP1-85818] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

COMT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYR
Specificity
Specificity of human, mouse, rat COMT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COMT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
COMT Lysate (NBP2-65831)
Control Peptide
COMT Protein (NBP1-85818PEP)
Publications
Read Publication using NBP1-85818.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COMT Antibody

  • catechol O-methyltransferase
  • catechol-O-methyltransferase
  • COMT
  • EC 2.1.1.6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-38868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS3921
Species: Hu, Mk, Pm
Applications: IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, ICC/IF, IHC, IHC-P, IP, PA, B/N
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF8216
Species: Hu, Mu, Rt
Applications: WB
NB300-174
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for COMT Antibody (NBP1-85818)(1)

Reviews for COMT Antibody (NBP1-85818) (0)

There are no reviews for COMT Antibody (NBP1-85818). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COMT Antibody (NBP1-85818) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for COMT Antibody (NBP1-85818)

Discover related pathways, diseases and genes to COMT Antibody (NBP1-85818). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COMT Antibody (NBP1-85818)

Discover more about diseases related to COMT Antibody (NBP1-85818).
 

Pathways for COMT Antibody (NBP1-85818)

View related products by pathway.

PTMs for COMT Antibody (NBP1-85818)

Learn more about PTMs related to COMT Antibody (NBP1-85818).
 

Research Areas for COMT Antibody (NBP1-85818)

Find related products by research area.

Blogs on COMT

There are no specific blogs for COMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COMT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COMT
Entrez