MAO-A Antibody

Western Blot: MAO-A Antibody [NBP2-38868] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: MAO-A Antibody [NBP2-38868] - Staining of human cell line RT4 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Analysis in human small intestine and lymph node tissues using HPA059299 antibody. Corresponding MAOA RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human lymph node shows no positivity in germinal center cells as expected.

Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MAO-A Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
• Specificity: Specificity of human MAO-A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAOA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MAO-A Antibody

• amine oxidase [flavin-containing] A
• EC 1.4.3
• EC 1.4.3.4
• MAOA
• MAO-A
• monoamine oxidase A
• Monoamine oxidase type A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAOA
• Uniprot:
  • P21397(Human)