MAO-A Antibody

Images

 
Western Blot: MAO-A Antibody [NBP2-38868] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: MAO-A Antibody [NBP2-38868] - Staining of human cell line RT4 shows localization to mitochondria. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Analysis in human small intestine and lymph node tissues using HPA059299 antibody. Corresponding MAOA RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human lymph node shows no positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MAO-A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
Specificity
Specificity of human MAO-A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAOA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAO-A Antibody

  • amine oxidase [flavin-containing] A
  • EC 1.4.3
  • EC 1.4.3.4
  • MAOA
  • MAO-A
  • monoamine oxidase A
  • Monoamine oxidase type A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
H00006532-D01P
Species: Hu, Mu
Applications: WB, Flow
NBP1-89671
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-62442
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl, IHC-WhMt
NLS3921
Species: Hu, Mk, Pm
Applications: IHC, IHC-P
NBP1-86922
Species: Hu
Applications: WB, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NLS1405
Species: Hu, Bt, Bv, Ca, Eq, Rb
Applications: IHC, IHC-P
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-182
Species: Hu, Mu, Rt, Ca, Kg, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45995
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAO-A Antibody (NBP2-38868) (0)

There are no publications for MAO-A Antibody (NBP2-38868).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAO-A Antibody (NBP2-38868) (0)

There are no reviews for MAO-A Antibody (NBP2-38868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAO-A Antibody (NBP2-38868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAO-A Products

Bioinformatics Tool for MAO-A Antibody (NBP2-38868)

Discover related pathways, diseases and genes to MAO-A Antibody (NBP2-38868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAO-A Antibody (NBP2-38868)

Discover more about diseases related to MAO-A Antibody (NBP2-38868).
 

Pathways for MAO-A Antibody (NBP2-38868)

View related products by pathway.

PTMs for MAO-A Antibody (NBP2-38868)

Learn more about PTMs related to MAO-A Antibody (NBP2-38868).

Blogs on MAO-A

There are no specific blogs for MAO-A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAO-A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAOA
Uniprot