Home » MAO-A » MAO-A Antibodies » MAO-A Antibody

MAO-A Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Analysis in human small intestine and lymph node tissues using HPA059299 antibody. Corresponding MAOA RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Analysis in human small intestine and lymph node tissues using HPA059299 antibody. Corresponding MAOA RNA-seq data are presented ...read more
Western Blot: MAO-A Antibody [NBP2-38868] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: MAO-A Antibody [NBP2-38868] - Staining of human cell line RT4 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human lymph node shows no positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

MAO-A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAOA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAO-A Protein (NBP2-38868PEP)
Publications
Read Publication using
NBP2-38868 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAO-A Antibody

  • amine oxidase [flavin-containing] A
  • EC 1.4.3
  • EC 1.4.3.4
  • MAOA
  • MAO-A
  • monoamine oxidase A
  • Monoamine oxidase type A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Monoamine Oxidase
B Antibody
NBP1-32426
Western Blot: Monoamine Oxidase B Antibody [NBP1-32426] - Whole cell extract (30 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Monoamine Oxidase B antibody [N2C3] diluted at 1:1500.
Immunohistochemistry-Paraffin: Monoamine Oxidase B Antibody [NBP1-32426] - Mouse liver. Monoamine Oxidase B stained by Monoamine Oxidase B antibody [N2C3] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunocytochemistry/Immunofluorescence: Monoamine Oxidase B Antibody [NBP1-32426] - HepG2 cells were fixed in ice-cold MeOH for 5 min. Green: Monoamine Oxidase B stained by Monoamine Oxidase B antibody [N2C3] diluted at 1:500. Blue: Hoechst 33342 staining.
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
COMT Antibody
NB100-1780
Western Blot: COMT Antibody [NB100-1780] - Staining of Human Liver (A) with antibody at 2 ug/mL and Ovary (B) lysate (35 ug protein in RIPA buffer) with antibody at 1 ug/mL. Detected by chemiluminescence.
Western Blot: COMT Antibody [NB100-1780] - Staining of MCF7 (A) with antibody at 0.5 ug/mL, U251 cell lysate 1 (B) and U251 cell lysate 2 (C) (35 ug protein in RIPA buffer) with antibody at 1 ug/mL. Detected by chemiluminescence.
Flow Cytometry: COMT Antibody [NB100-1780] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(3 Publications)
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB

SLC6A4/5-HTTLPR/Seroto ...
H00006532-D01P
Flow Cytometry: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Fixed and permeabilized mouse mast cells were stained for 1 hour in 4C then stained with PE secondary and ran on FACS. Image from verified customer review.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in transfected 293T cell line by SLC6A4 polyclonal antibody. Lane 1: SLC6A4 transfected lysate (70.30 KDa). Lane 2: Non-transfected lysate.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in mouse lung.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB
VAP-1/AOC3 Antibody
NBP1-89671
Western Blot: VAP-1/AOC3 Antibody [NBP1-89671] - Analysis in control (vector only transfected HEK293T lysate) and aOC3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: VAP-1/AOC3 Antibody [NBP1-89671] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: VAP-1/AOC3 Antibody [NBP1-89671] - Analysis in human lung and skeletal muscle tissues. Corresponding AOC3 RNA-seq data are presented for the same tissues.
(1 Review)
(2 Publications)
Species: Eq, Hu
Applications: IHC, IHC-P, WB
Recombinant Human
AOC2 GST (N-Term) Pro ...
H00000314-P01
SDS-Page: Recombinant Human AOC2 Protein [H00000314-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
SLC6A3/DAT1
Antibody (mAb16)
NBP2-22164
Western Blot: SLC6A3/DAT1 Antibody (mAb16) [NBP2-22164] - Western blot analysis of DAT protein. Band shown at approx. 75 kDa. Image submitted by verified customer review.
Western Blot: DAT1 Antibody (mAb16) [NBP2-22164] - Analysis of DAT1 expression in rat striatal membrane tissue lysate.
Immunohistochemistry-Paraffin: DAT1 Antibody (mAb16) [NBP2-22164] - IHC analysis of DAT1 in mouse brain using DAB with hematoxylin counterstain.
(3 Reviews)
(13 Publications)
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the mushroom body. All panels show a right brain hemisphere (dorsal to the top, medial to the right), except panels M-O (posterior to the top). Tyrosine hydroxylase (TH) immunoreactivity is shown in magenta (A, D, G, J, M) and synapsin immunoreactivity in green (B, E, H, K, N). Corresponding merged images in C, F, I, L, O. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
(7 Reviews)
(175 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Dopamine Receptor
D4 Antibody - BSA Fre ...
NLS3921
Immunohistochemistry-Paraffin: Dopamine Receptor D4 Antibody [NLS3921] - Staining of human brain, Neurons and Glia
Immunohistochemistry-Paraffin: Dopamine Receptor D4 Antibody [NLS3921] - Analysis of anti-DRD4 / Dopamine Receptor D4 antibody with human brain, glioblastoma.
Immunohistochemistry-Paraffin: Dopamine Receptor D4 Antibody [NLS3921] - Anti-DRD4 / Dopamine Receptor D4 antibody IHC of human Ovary, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
Tryptophan
Hydroxylase 1/TPH-1 A
NBP1-86922
Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining in human small intestine and liver tissues . Corresponding TPH1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
(1 Review)
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Calreticulin
Antibody - BSA Free
NB600-101
Knockdown Validated: Calreticulin Antibody [NB600-101] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Calreticulin knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1500 of Rabbit Anti-Human Calreticulin Polyclonal Antibody (Catalog # NB600-101) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Calreticulin at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Calreticulin Antibody [NB600-101] - Human kidney lysate.
Immunocytochemistry/Immunofluorescence: Calreticulin Antibody [NB600-101] - The Calreticulin antibody NB600-101 was tested in HeLa cells at a 1:250 dilution against DyLight 488 (Green). Alpha-tubulin and nuclei were counterstained against DyLight 550 (Red) and DAPI (Blue), respectively.
(27 Publications)
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Dopamine D2R/DRD2
Antibody
NBP2-88996
ELISA: Dopamine D2R/DRD2 Antibody [NBP2-88996] - HEK293 cells expressing dopamine receptor (D2) were treated with indicated concentrations of agonist (Quinpirol) and antagonist (Siperone) and probed with Dopamine Receptor (D2) pAb (1:1000 of a stock solution of 1ug/uL) by cellular ELISA. Data from vehicle treated cells were taken as 100%. Results are the mean -+SEM (n=3).
Immunohistochemistry: Dopamine D2R/DRD2 Antibody [NBP2-88996] - Rat cerebral cortex. Neurons are labeled with Dopamine Receptor (D2) pAb in conjunction with Cy3 conjugated rabbit IgG antibody (H+L).
Western Blot: Dopamine D2R/DRD2 Antibody [NBP2-88996] - MW marker (1) and 10ug of rat heart membrane extract (2) probed with Dopamine Receptor (D2) pAb at 4.0ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Dopamine
beta-Hydroxylase Anti
NBP1-31386
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP1-31386] - Paraffin-embedded U87 xenograft; antibody dilution 1:500.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP1-31386] - Paraffin-embedded mouse brain.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP1-31386] - Paraffin-embedded RT2 xenograft; antibody dilution 1:500.
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of THP-1 cell lysate.
Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 18) [NB100-74510] - Staining of PS1 in mouse fibroblasts.
Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of Presenilin 1 using Presenilin 1 Monoclonal antibody (APS 18) shows staining in MCF-7 cells. Presenilin 1 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Presenilin 1 at a dilution of 1:20-1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
BRCA2 Antibody
(234403) [Unconjugate
MAB2476
Western blot shows lysates of Capan‑1 human pancreatic adenocarcinoma cell line, HeLa human cervical epithelial carcinoma cell line, and U2OS human osteosarcoma cell line. PVDF membrane was probed with 0.2 µg/mL of Human BRCA2 Monoclonal Antibody (Catalog # MAB2476) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for BRCA2 at approximately 380 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Publications)
Species: Hu
Applications: IHC, WB
FANCD2 Antibody -
BSA Free
NB100-182
Immunocytochemistry/Immunofluorescence: FANCD2 Antibody [NB100-182] - Analysis using the Biotin conjugate of FANCD2 Antibody. FANCD2 colocalizes in vivo with another protein in SiHa cells after cell exposure to IR. Proliferating SiHa cells were exposed to 10 Gy of IR and double color immunofluorescence staining was performed after 8 h. Images were captured in a Kodak digital image system on a Leica fluorescence microscope.
Knockdown Validated: FANCD2 Antibody [NB100-182] - Resistance of FANCA-mutant cells with defective FANCD2 function to hydrogen peroxide (H2O2). Representative images illustrating staining for subnuclear FANCD2 foci in isogenic fibroblast pairs, either deficient for FANCD2 (PD20) or FANCA (PD220) and their respective wild-type (wt) complemented counterparts. Foci were visualized three hours after treatment with H2O2 (25 uM for 2 hours). Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/bmri/2008/821529/) licensed under a CC-BY licence.
Western Blot: FANCD2 Antibody [NB100-182] - AICAR-induced FANCD2 monoubiquitination is dependent on AMPK. Inhibitor of AMPK blocks AICAR-induced FANCD2 monoubiquitination in GM00637I normal fibroblasts. Cells were pretreated with 5 um of Compound C (an AMPK inhibitor) 1 h before treatment with 0.25 mm AICAR for 24 h. Cell lysates were subjected to immunoblotting with FANCD2 Antibody to visualize monoubiquitinated FANCD2 (Ub-ANCD2). Image collected and cropped by CiteAb from the following publication (http://doi.wiley.com/10.1002/2211-5463.12185) licensed under a CC-BY licence.
(8 Reviews)
(191 Publications)
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
5-HT2A Antibody
NBP2-26091
Immunocytochemistry/Immunofluorescence: 5-HT2A Antibody [NBP2-26091] - Immunofluorescence analysis of paraformaldehyde fixed A549 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Flow Cytometry: 5-HT2A Antibody [NBP2-26091] - Flow cytometric analysis of paraformaldehyde fixed A549 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP2-26091] - Negative Control showing staining of paraffin embedded Human Cerebellum, with no primary antibody.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
5-HT1A Antibody
NBP2-21590
Immunocytochemistry/Immunofluorescence: 5-HT1A Antibody [NBP2-21590] - DIV14 rat E18 primary cortical neurons were fixed in 4% paraformaldehyde at RT for 15 min. Green: 5-HT1A receptor protein stained by 5-HT1A receptor antibody [N3C1], Internal diluted at 1:500. Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Frozen: 5-HT1A Antibody [NBP2-21590] - Frozen Sectioned adult mouse hippocampus. Green: 5-HT1A receptor protein stained by 5-HT1A receptor antibody [N3C1], Internal diluted at 1:250.Blue: Fluoroshield with DAPI.
Western Blot: 5-HT1A Antibody [NBP2-21590] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with 5-HT1A receptor antibody [N3C1], Internal diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-Fr, Simple Western, WB
TDO2 Antibody
H00006999-B01P
Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in transfected 293T cell line by TDO2 polyclonal antibody. Lane 1: TDO2 transfected lysate(44.66 KDa). Lane 2: Non-transfected lysate.
Knockout Validated: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot. The total protein (20 ug) of the dentate gyrus, extracted from the wild-type (lanes 1 and 3) and Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, and transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta-Tubulin is a positive control for the Western blot. Image collected and cropped by CiteAb from the following publication (http://molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY licence.
Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. A TDO was not stained in the SVZ. The immunoreactivities for TDO in wild type and Tdo-/- mice were background level. Image collected and cropped by CiteAb from the following publication (http://molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY licence.
(4 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAO-A Antibody
NBP2-38868
MAO-A Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAO-A Antibody (NBP2-38868)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for MAO-A Antibody (NBP2-38868) (0)

There are no reviews for MAO-A Antibody (NBP2-38868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAO-A Antibody (NBP2-38868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAO-A Products

Bioinformatics Tool for MAO-A Antibody (NBP2-38868)

Discover related pathways, diseases and genes to MAO-A Antibody (NBP2-38868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAO-A Antibody (NBP2-38868)

Discover more about diseases related to MAO-A Antibody (NBP2-38868).
 

Pathways for MAO-A Antibody (NBP2-38868)

View related products by pathway.

PTMs for MAO-A Antibody (NBP2-38868)

Learn more about PTMs related to MAO-A Antibody (NBP2-38868).
 

Research Areas for MAO-A Antibody (NBP2-38868)

Find related products by research area.

Blogs on MAO-A

There are no specific blogs for MAO-A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAO-A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MAOA
Uniprot