MAO-A Antibody

Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Analysis in human small intestine and lymph node tissues using HPA059299 antibody. Corresponding MAOA RNA-seq data are presented for the same tissues.

Western Blot: MAO-A Antibody [NBP2-38868] - Analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: MAO-A Antibody [NBP2-38868] - Staining of human cell line RT4 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human lymph node shows no positivity in germinal center cells as expected.

Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MAO-A Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAOA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MAO-A Protein (NBP2-38868PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MAO-A Antibody

• amine oxidase [flavin-containing] A
• EC 1.4.3
• EC 1.4.3.4
• MAOA
• MAO-A
• monoamine oxidase A
• Monoamine oxidase type A

Background

Monoamine Oxidase A catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAO-A Antibody (NBP2-38868)(1)

Publication using NBP2-38868

• Shui X, Ren X, Xu R et al. Monoamine oxidase A drives neuroendocrine differentiation in prostate cancer Biochemical and biophysical research communications 2022-03-23 [PMID: 35349822] (WB, IF/IHC, Human, Mouse)

Bioinformatics

• Gene Symbol: MAOA
• Uniprot:
  • P21397(Human)