MAO-A Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Analysis in human small intestine and lymph node tissues using HPA059299 antibody. Corresponding MAOA RNA-seq data are presented ...read more
Western Blot: MAO-A Antibody [NBP2-38868] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: MAO-A Antibody [NBP2-38868] - Staining of human cell line RT4 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human lymph node shows no positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MAO-A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAOA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAO-A Protein (NBP2-38868PEP)
Publications
Read Publication using
NBP2-38868 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAO-A Antibody

  • amine oxidase [flavin-containing] A
  • EC 1.4.3
  • EC 1.4.3.4
  • MAOA
  • MAO-A
  • monoamine oxidase A
  • Monoamine oxidase type A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32426
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP1-89671
Species: Eq, Hu
Applications: IHC, IHC-P, WB
H00000314-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NLS3921
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
NBP1-86922
Species: Hu
Applications: IHC, IHC-P, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
NBP2-88996
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-21590
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-Fr, Simple Western, WB
H00006999-B01P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-38868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAO-A Antibody (NBP2-38868)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for MAO-A Antibody (NBP2-38868) (0)

There are no reviews for MAO-A Antibody (NBP2-38868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAO-A Antibody (NBP2-38868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAO-A Products

Bioinformatics Tool for MAO-A Antibody (NBP2-38868)

Discover related pathways, diseases and genes to MAO-A Antibody (NBP2-38868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAO-A Antibody (NBP2-38868)

Discover more about diseases related to MAO-A Antibody (NBP2-38868).
 

Pathways for MAO-A Antibody (NBP2-38868)

View related products by pathway.

PTMs for MAO-A Antibody (NBP2-38868)

Learn more about PTMs related to MAO-A Antibody (NBP2-38868).
 

Research Areas for MAO-A Antibody (NBP2-38868)

Find related products by research area.

Blogs on MAO-A

There are no specific blogs for MAO-A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAO-A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAOA
Uniprot