Home » MAO-A » MAO-A Antibodies » MAO-A Antibody

MAO-A Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: MAO-A Antibody [NBP2-38868] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Western Blot: MAO-A Antibody [NBP2-38868] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: MAO-A Antibody [NBP2-38868] - Staining of human cell line RT4 shows localization to mitochondria. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Analysis in human small intestine and lymph node tissues using HPA059299 antibody. Corresponding MAOA RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human lymph node shows no positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MAO-A Antibody [NBP2-38868] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

MAO-A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
Specificity
Specificity of human MAO-A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAOA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAO-A Protein (NBP2-38868PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAO-A Antibody

  • amine oxidase [flavin-containing] A
  • EC 1.4.3
  • EC 1.4.3.4
  • MAOA
  • MAO-A
  • monoamine oxidase A
  • Monoamine oxidase type A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Monoamine Oxidase
B Antibody
NBP1-87493
Immunohistochemistry-Paraffin: Monoamine Oxidase B Antibody [NBP1-87493] - Staining in human liver and testis tissues. Corresponding MAOB RNA-seq data are presented for the same tissues.
Western Blot: Monoamine Oxidase B Antibody [NBP1-87493] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: Monoamine Oxidase B Antibody [NBP1-87493] - Analysis in human liver tissue.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
COMT Antibody
NB100-41387
Western Blot: COMT Antibody [NB100-41387] - Staining of human testis lysate (35ug protein in RIPA buffer) with Goat Anti-COMT (internal) (0.03ug/ml). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: COMT Antibody [NB100-41387] - staining of paraffin embedded Human Testis. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: COMT Antibody [NB100-41387] - (4ug/ml) staining of paraffin embedded Human Cerebellum. Microwaved antigen retrieval with Tris/EDTA buffer pH9, HRP-staining.
(1 Publication)
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA

SLC6A4/5-HTTLPR/Seroto ...
NB100-1892
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [NB100-1892] - Human Colon lysate, 35 ug protein in RIPA buffer. Antibody at 2 ug/mL. Detection by chemiluminescence.
Immunocytochemistry/Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [NB100-1892] - Analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
VAP-1/AOC3 Antibody
NBP1-89671
Western Blot: VAP-1/AOC3 Antibody [NBP1-89671] - Analysis in control (vector only transfected HEK293T lysate) and aOC3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: VAP-1/AOC3 Antibody [NBP1-89671] - Equine endometrium. All vascular smooth muscle was positively stained. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: VAP-1/AOC3 Antibody [NBP1-89671] - Staining of human lung shows high expression.
(1 Review)
(2 Publications)
Species: Hu, Eq
Applications: WB, IHC, IHC-P
Recombinant Human
AOC2 GST (N-Term) Pro ...
H00000314-Q01
SDS-Page: Recombinant Human AOC2 Protein [H00000314-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
SLC6A3/DAT1
Antibody (mAb16)
NBP2-22164
Western Blot: SLC6A3/DAT1 Antibody (mAb16) [NBP2-22164] - Western blot analysis of DAT protein. Band shown at approx. 75 kDa. Image submitted by verified customer review.
Immunocytochemistry/Immunofluorescence: DAT1 Antibody (mAb16) [NBP2-22164] - The DAT1 antibody was tested in PC12 cells at a 1:250 dilution against DyLight 488 (Green). Actin and nuclei were counterstained with Phalloidin-AlexaFluor 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: DAT1 Antibody (mAb16) [NBP2-22164] - IHC analysis of DAT1 in mouse brain using DAB with hematoxylin counterstain.
(3 Reviews)
(12 Publications)
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Tyrosine Hydroxylase Antibody [NB300-109] - Dopamine neurons in the mouse substantia nigra. ICC/IF image submitted by a verified customer review.
Simple Western: Tyrosine Hydroxylase Antibody [NB300-109] - Simple Western lane view shows a specific band for Tyrosine Hydroxylase in 0.2 mg/mL of PC-12 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(7 Reviews)
(143 Publications)
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
Dopamine Receptor
D4 Antibody
NBP2-92717
Western Blot: Dopamine Receptor D4 Antibody [NBP2-92717] - Analysis of extracts of various cell lines, using Dopamine Receptor D4 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
Immunohistochemistry-Paraffin: Dopamine Receptor D4 Antibody [NBP2-92717] - Paraffin-embedded rat retina using Dopamine Receptor D4.
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Tryptophan
Hydroxylase 1/TPH-1 A
NBP1-86922
Western Blot: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Human melanoma cell line A375 and 5 patient melanoma tissue samples. 15 ug cell lysate per lane. TPH1 antibody at 1:400, 4C O/N. WB image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
Calreticulin
Antibody
NB600-101
Knockdown Validated: Calreticulin Antibody [NB600-101] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Calreticulin knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1500 of Rabbit Anti-Human Calreticulin Polyclonal Antibody (Catalog # NB600-101) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Calreticulin at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Calreticulin Antibody [NB600-101] - Human kidney lysate.
Immunocytochemistry/Immunofluorescence: Calreticulin Antibody [NB600-101] - Immunofluorescence staining of Calreticulin in HCT15 colon cancer cells using NB600-101. Secondary antibody was conjugated with Alexa Fluor 488. Photo courtesy of Dr. Birkenkamp Demtroeder, Arhus University Hospital.
(24 Publications)
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
Dopamine D2R/DRD2
Antibody
NLS1403
Immunohistochemistry-Paraffin: Dopamine D2 R/DRD2 Antibody [NLS1403] - Analysis of anti-DRD2 antibody with human brain, neurons and glia at 3 ug/ml.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
Dopamine
beta-Hydroxylase Anti
NBP1-31386
Western Blot: Dopamine beta-Hydroxylase Antibody [NBP1-31386] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membranes were blotted with Dopamine beta hydroxylase antibody and a competitor's antibody. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP1-31386] - Paraffin-embedded RT2 xenograft; antibody dilution 1:500.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP1-31386] - Paraffin-embedded U87 xenograft; antibody dilution 1:500.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of THP-1 cell lysate.
Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of Presenilin 1 using Presenilin 1 Monoclonal antibody (APS 18) shows staining in A2058 melanoma cells. Presenilin 1 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Presenilin 1 at a dilution of 1:20-1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Presenilin-1 Antibody (APS 18) [NB100-74510] - Normal biopsies of deparaffinized Human liver tissue.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
BRCA2 Antibody
NBP1-88361
Immunocytochemistry/Immunofluorescence: BRCA2 Antibody [NBP1-88361] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Flow Cytometry: BRCA2 Antibody [NBP1-88361] - DNA damage induced by low-dose radiation and cfDNAox and cfDNAoxR fragments activates reparation of nuclear DNA. (a) (1) Flow cytometry detection of BRCA2 in irradiated (10cGy) and control cells stained with anti-BRCA2 antibodies and secondary FITC-conjugated antibodies. Gate R encircles the fraction of MSCs with elevated values of FL1- BRCA2; (2) distribution of cells with varying BRCA2 contents. Image collected and cropped by CiteAb from the following publication (hindawi.com/journals/omcl/2017/9515809/), licensed under a CC-BY licence.
(4 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
FANCD2 Antibody
NB100-182
Knockdown Validated: FANCD2 Antibody [NB100-182] - Effects of FANCD2 knockdown on levels of cell cycle regulators. Caki-1 cells were transfected with control siRNA (siCon) or FANCD2 siRNA (siFD2#2) and treated with AICAR for 24 h. The levels of FANCD2, p15Ink4B, and p21Cip1 were evaluated by immunoblotting. Image collected and cropped by CiteAb from the following publication (http://doi.wiley.com/10.1002/2211-5463.12185) licensed under a CC-BY licence.
Knockdown Validated: FANCD2 Antibody [NB100-182] - Resistance of FANCA-mutant cells with defective FANCD2 function to hydrogen peroxide (H2O2). Representative images illustrating staining for subnuclear FANCD2 foci in isogenic fibroblast pairs, either deficient for FANCD2 (PD20) or FANCA (PD220) and their respective wild-type (wt) complemented counterparts. Foci were visualized three hours after treatment with H2O2 (25 uM for 2 hours). Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/bmri/2008/821529/) licensed under a CC-BY licence.
Western Blot: FANCD2 Antibody [NB100-182] - AMPK-activating AICAR treatment activates FANCD2, a pivotal molecule of Fanconi anemia DNA damage signaling pathway. AICAR treatment induces FANCD2 monoubiquitination in transformed normal fibroblasts (GM00637I). GM00637I cells were treated with 1 mm 2-deoxyglucose, 0.25 mM AICAR, or 1 mm phenformin for 24 h. Lysates were subjected to western blotting with FANCD2 Antibody, phospho-AMPKalpha1 (T172), and AMPKalpha and beta-actin. In FANCD2 blots, the position of monoubiquitinated FANCD2 (Ub-FANCD2) is indicated by an arrow. Image collected and cropped by CiteAb from the following publication (http://doi.wiley.com/10.1002/2211-5463.12185) licensed under a CC-BY licence.
(8 Reviews)
(183 Publications)
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
5-HT2A Antibody
NBP2-26091
Immunocytochemistry/Immunofluorescence: 5-HT2A Antibody [NBP2-26091] - Immunofluorescence analysis of paraformaldehyde fixed A549 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP2-26091] - Staining of paraffin embedded Human Cerebellum. Antibody at 2 ug/mL. Microwaved antigen retrieval with citrate buffer pH 6, HRP-staining.
Flow Cytometry: 5-HT2A Antibody [NBP2-26091] - Flow cytometric analysis of paraformaldehyde fixed A549 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
5-HT1A Antibody
NBP2-21590
Western Blot: 5-HT1A Antibody [NBP2-21590] - Various tissue extracts (50 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with 5-HT1A receptor antibody [N3C1], Internal diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: 5-HT1A Antibody [NBP2-21590] - DIV14 rat E18 primary cortical neurons were fixed in 4% paraformaldehyde at RT for 15 min. Green: 5-HT1A receptor protein stained by 5-HT1A receptor antibody [N3C1], Internal diluted at 1:500. Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Frozen: 5-HT1A Antibody [NBP2-21590] - Frozen Sectioned adult mouse hippocampus. Green: 5-HT1A receptor protein stained by 5-HT1A receptor antibody [N3C1], Internal diluted at 1:250.Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
TDO2 Antibody
H00006999-B01P
Knockout Validated: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot. The total protein (20 ug) of the dentate gyrus, extracted from the wild-type (lanes 1 and 3) and Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, and transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta-Tubulin is a positive control for the Western blot. Image collected and cropped by CiteAb from the following publication (http://molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY licence.
Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in transfected 293T cell line by TDO2 polyclonal antibody. Lane 1: TDO2 transfected lysate(44.66 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. In the cerebellum, the immunoreactivity for TDO was observed in granule cells and Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. Image collected and cropped by CiteAb from the following publication (http://molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY licence.
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAO-A Antibody
NBP2-38868
MAO-A Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAO-A Antibody (NBP2-38868) (0)

There are no publications for MAO-A Antibody (NBP2-38868).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAO-A Antibody (NBP2-38868) (0)

There are no reviews for MAO-A Antibody (NBP2-38868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAO-A Antibody (NBP2-38868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional MAO-A Products

Bioinformatics Tool for MAO-A Antibody (NBP2-38868)

Discover related pathways, diseases and genes to MAO-A Antibody (NBP2-38868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAO-A Antibody (NBP2-38868)

Discover more about diseases related to MAO-A Antibody (NBP2-38868).
 

Pathways for MAO-A Antibody (NBP2-38868)

View related products by pathway.

PTMs for MAO-A Antibody (NBP2-38868)

Learn more about PTMs related to MAO-A Antibody (NBP2-38868).

Blogs on MAO-A

There are no specific blogs for MAO-A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAO-A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MAOA
Uniprot