MAO-A Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS |
Specificity |
Specificity of human MAO-A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MAOA |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 0.04-0.4 ug/ml
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for MAO-A Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
Species: Hu, Eq
Applications: WB, IHC, IHC-P
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Publications for MAO-A Antibody (NBP2-38868) (0)
There are no publications for MAO-A Antibody (NBP2-38868).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MAO-A Antibody (NBP2-38868) (0)
There are no reviews for MAO-A Antibody (NBP2-38868).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MAO-A Antibody (NBP2-38868) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional MAO-A Products
Bioinformatics Tool for MAO-A Antibody (NBP2-38868)
Discover related pathways, diseases and genes to MAO-A Antibody (NBP2-38868). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for MAO-A Antibody (NBP2-38868)
Discover more about diseases related to MAO-A Antibody (NBP2-38868).
| | Pathways for MAO-A Antibody (NBP2-38868)
View related products by pathway.
|
PTMs for MAO-A Antibody (NBP2-38868)
Learn more about PTMs related to MAO-A Antibody (NBP2-38868).
|
Blogs on MAO-A