Complement Factor B Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: VDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CFB |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82)%
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, containing 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Complement Factor B Antibody
Background
Complement factor B is a component of the alternative pathway of complement activation. Factor B circulates in the blood as a single chain polypeptide. Upon activation of the alternative pathway, it is cleaved by complement factor D yielding the noncatalytic chain Ba and the catalytic subunit Bb. The active subunit Bb is a serine protease that associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. This cluster includes several genes involved in regulation of the immune reaction. The polyadenylation site of this gene is 421 bp from the 5' end of the gene for complement component 2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Pm
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF
Publications for Complement Factor B Antibody (NBP2-76494) (0)
There are no publications for Complement Factor B Antibody (NBP2-76494).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Complement Factor B Antibody (NBP2-76494) (0)
There are no reviews for Complement Factor B Antibody (NBP2-76494).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Complement Factor B Antibody (NBP2-76494) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Complement Factor B Products
Bioinformatics Tool for Complement Factor B Antibody (NBP2-76494)
Discover related pathways, diseases and genes to Complement Factor B Antibody (NBP2-76494). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Complement Factor B Antibody (NBP2-76494)
Discover more about diseases related to Complement Factor B Antibody (NBP2-76494).
| | Pathways for Complement Factor B Antibody (NBP2-76494)
View related products by pathway.
|
PTMs for Complement Factor B Antibody (NBP2-76494)
Learn more about PTMs related to Complement Factor B Antibody (NBP2-76494).
| | Research Areas for Complement Factor B Antibody (NBP2-76494)
Find related products by research area.
|
Blogs on Complement Factor B