Complement C5 Antibody

Images

 
Immunohistochemistry-Paraffin: Complement C5 Antibody [NBP1-84395] - Staining of human testis shows moderate cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Complement C5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Complement C5 Protein (NBP1-84395PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Complement C5 Antibody

  • anaphylatoxin C5a analog
  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4
  • C5
  • complement C5
  • complement component 5
  • CPAMD4MGC142298
  • FLJ17816
  • FLJ17822

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11867
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NB100-63270
Species: Hu
Applications: WB, ELISA
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
MAB8126
Species: Hu
Applications: WB, Simple Western
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
H00000712-P01
Species: Hu

Publications for Complement C5 Antibody (NBP1-84395) (0)

There are no publications for Complement C5 Antibody (NBP1-84395).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement C5 Antibody (NBP1-84395) (0)

There are no reviews for Complement C5 Antibody (NBP1-84395). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Complement C5 Antibody (NBP1-84395) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement C5 Products

Bioinformatics Tool for Complement C5 Antibody (NBP1-84395)

Discover related pathways, diseases and genes to Complement C5 Antibody (NBP1-84395). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement C5 Antibody (NBP1-84395)

Discover more about diseases related to Complement C5 Antibody (NBP1-84395).
 

Pathways for Complement C5 Antibody (NBP1-84395)

View related products by pathway.

PTMs for Complement C5 Antibody (NBP1-84395)

Learn more about PTMs related to Complement C5 Antibody (NBP1-84395).
 

Research Areas for Complement C5 Antibody (NBP1-84395)

Find related products by research area.

Blogs on Complement C5.

Complement C3 - the most important protein in the complement system
The complement system is made up of a collection of proteins found in the bloodstream and is comprised of nine major complement proteins; complement C3 is one of them. The complement system is a crucial component of the cellular immune system becau...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement C5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C5