![Western Blot: COMMD3 Antibody [NBP1-88519] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cell).](http://images.novusbio.com/fullsize/COMMD3-Antibody-Western-Blot-NBP1-88519-img0006.jpg "Western Blot: COMMD3 Antibody [NBP1-88519] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cell).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COMMD3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for COMMD3 Antibody (NBP1-88519)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COMMD3 |
![Immunohistochemistry-Paraffin: COMMD3 Antibody [NBP1-88519] - Staining of human Kidney shows strong cytoplasmic positivity in cells in glomeruli and tubules.](http://images.novusbio.com/fullsize/COMMD3-Antibody-Immunohistochemistry-Paraffin-NBP1-88519-img0012.jpg "Immunohistochemistry-Paraffin: COMMD3 Antibody [NBP1-88519] - Staining of human Kidney shows strong cytoplasmic positivity in cells in glomeruli and tubules.")
![Immunohistochemistry-Paraffin: COMMD3 Antibody [NBP1-88519] - Staining of human breast shows strong membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/COMMD3-Antibody-Immunohistochemistry-Paraffin-NBP1-88519-img0007.jpg "Immunohistochemistry-Paraffin: COMMD3 Antibody [NBP1-88519] - Staining of human breast shows strong membranous and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: COMMD3 Antibody [NBP1-88519] - Staining of human fallopian tube shows strong membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/COMMD3-Antibody-Immunohistochemistry-Paraffin-NBP1-88519-img0008.jpg "Immunohistochemistry-Paraffin: COMMD3 Antibody [NBP1-88519] - Staining of human fallopian tube shows strong membranous and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: COMMD3 Antibody [NBP1-88519] - Staining of human small intestine shows moderate membranous and ctyoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/COMMD3-Antibody-Immunohistochemistry-Paraffin-NBP1-88519-img0010.jpg "Immunohistochemistry-Paraffin: COMMD3 Antibody [NBP1-88519] - Staining of human small intestine shows moderate membranous and ctyoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: COMMD3 Antibody [NBP1-88519] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trhophoblastic cells.](http://images.novusbio.com/fullsize/COMMD3-Antibody-Immunohistochemistry-Paraffin-NBP1-88519-img0011.jpg "Immunohistochemistry-Paraffin: COMMD3 Antibody [NBP1-88519] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trhophoblastic cells.")
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")