POLD4 Antibody (2C11)

Images

 
ELISA: POLD4 Antibody (2C11) [H00057804-M10] - Detection limit for recombinant GST tagged POLD4 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

POLD4 Antibody (2C11) Summary

Immunogen
POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Specificity
POLD4 (2C11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POLD4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00057804-M10.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLD4 Antibody (2C11)

  • DNA polymerase delta smallest subunit p12
  • DNA polymerase delta subunit p12
  • p12
  • POLDSDNA polymerase delta subunit 4
  • polymerase (DNA-directed), delta 4

Background

The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POLD4 Antibody (H00057804-M10)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for POLD4 Antibody (H00057804-M10) (0)

There are no reviews for POLD4 Antibody (H00057804-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLD4 Antibody (H00057804-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLD4 Products

Research Areas for POLD4 Antibody (H00057804-M10)

Find related products by research area.

Blogs on POLD4

There are no specific blogs for POLD4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLD4 Antibody (2C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol POLD4
Entrez
Uniprot