POLE4 Antibody


Immunohistochemistry: POLE4 Antibody [NBP2-49672] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

POLE4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
Specificity of human POLE4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
POLE4 Recombinant Protein Antigen (NBP2-49672PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for POLE4 Antibody

  • DNA polymerase epsilon p12 subunit
  • DNA polymerase epsilon subunit 4
  • DNA polymerase epsilon subunit p12
  • DNA polymerase II subunit 4
  • EC
  • p12
  • polymerase (DNA-directed), epsilon 4 (p12 subunit)
  • YHHQ1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ch
Applications: WB, IP
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for POLE4 Antibody (NBP2-49672) (0)

There are no publications for POLE4 Antibody (NBP2-49672).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLE4 Antibody (NBP2-49672) (0)

There are no reviews for POLE4 Antibody (NBP2-49672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for POLE4 Antibody (NBP2-49672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for POLE4 Antibody (NBP2-49672)

Discover related pathways, diseases and genes to POLE4 Antibody (NBP2-49672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLE4 Antibody (NBP2-49672)

Discover more about diseases related to POLE4 Antibody (NBP2-49672).

Pathways for POLE4 Antibody (NBP2-49672)

View related products by pathway.

PTMs for POLE4 Antibody (NBP2-49672)

Learn more about PTMs related to POLE4 Antibody (NBP2-49672).

Research Areas for POLE4 Antibody (NBP2-49672)

Find related products by research area.

Blogs on POLE4

There are no specific blogs for POLE4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our POLE4 Antibody and receive a gift card or discount.


Gene Symbol POLE4