SPAG6 Antibody

Images

 
Western Blot: SPAG6 Antibody [NBP1-80923] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: SPAG6 Antibody [NBP1-80923] - Staining of human fallopian tube shows strong membranous positivity in cilia of glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPAG6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPAG6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPAG6 Protein (NBP1-80923PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-80923 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPAG6 Antibody

  • axoneme central apparatus protein
  • DKFZp434I153
  • pf16
  • Protein PF16 homolog
  • Repro-SA-1MGC26276
  • sperm associated antigen 6
  • Sperm flagellar protein
  • sperm-associated antigen 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84124
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-87928
Species: Hu
Applications: IHC, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88519
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2628
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1936
Species: Hu
Applications: WB, IP
NBP1-98474
Species: Hu
Applications: WB
AF5286
Species: Hu
Applications: WB
NBP1-84754
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-49672
Species: Hu
Applications: IHC

Publications for SPAG6 Antibody (NBP1-80923) (0)

There are no publications for SPAG6 Antibody (NBP1-80923).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for SPAG6 Antibody (NBP1-80923) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-80923:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SPAG6 NBP1-80923
Enlarge
reviewed by:
Livia Pellegrini
WB Mouse 04/05/2017
View

Summary

ApplicationWestern Blot
Sample TestedAdult testis,Adult mouse brain tissue
SpeciesMouse
LotA106213

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPAG6 Antibody (NBP1-80923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPAG6 Products

Bioinformatics Tool for SPAG6 Antibody (NBP1-80923)

Discover related pathways, diseases and genes to SPAG6 Antibody (NBP1-80923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPAG6 Antibody (NBP1-80923)

Discover more about diseases related to SPAG6 Antibody (NBP1-80923).
 

Pathways for SPAG6 Antibody (NBP1-80923)

View related products by pathway.

PTMs for SPAG6 Antibody (NBP1-80923)

Learn more about PTMs related to SPAG6 Antibody (NBP1-80923).

Blogs on SPAG6

There are no specific blogs for SPAG6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Livia Pellegrini
04/05/2017
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol SPAG6