SPAG6 Antibody

Images

 
Western Blot: SPAG6 Antibody [NBP1-80923] - Analysis in control (vector only transfected HEK293T lysate) and SPAG6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: SPAG6 Antibody [NBP1-80923] - Staining in human fallopian tube and colon tissues using anti-SPAG6 antibody. Corresponding SPAG6 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: SPAG6 Antibody [NBP1-80923] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: SPAG6 Antibody [NBP1-80923] - Staining of human fallopian tube shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SPAG6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEA
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPAG6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot verified by a customer review.
Control Peptide
SPAG6 Protein (NBP1-80923PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-80923 in the following applications:

Publications
Read Publication using
NBP1-80923 in the following applications:

  • WB
    1 publication

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:30865884).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPAG6 Antibody

  • axoneme central apparatus protein
  • DKFZp434I153
  • pf16
  • Protein PF16 homolog
  • Repro-SA-1MGC26276
  • sperm associated antigen 6
  • Sperm flagellar protein
  • sperm-associated antigen 6

Background

The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from an infertile man. This protein localizes to the tail of permeabilized human sperm and contains eight contiguous armadillo repeats, a motif known to mediate protein-protein interactions. Studies in mice suggest that this protein is involved in sperm flagellar motility and maintenance of the structural integrity of mature sperm. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPAG6 Antibody (NBP1-80923)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for SPAG6 Antibody (NBP1-80923) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-80923:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SPAG6 NBP1-80923
Enlarge
3
reviewed by:
Livia Pellegrini
WB Mouse 04/05/2017
View

Summary

ApplicationWestern Blot
Sample TestedAdult mouse brain tissue,Adult testis
SpeciesMouse
LotA106213

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPAG6 Antibody (NBP1-80923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Livia Pellegrini
04/05/2017
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol SPAG6
Entrez
Uniprot