![Western Blot: SPAG6 Antibody [NBP1-80923] - Analysis in control (vector only transfected HEK293T lysate) and SPAG6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/SPAG6-Antibody-Western-Blot-NBP1-80923-img0009.jpg "Western Blot: SPAG6 Antibody [NBP1-80923] - Analysis in control (vector only transfected HEK293T lysate) and SPAG6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SPAG6 Antibody - BSA Free (NBP1-80923) is a polyclonal antibody validated for use in IHC and WB. Anti-SPAG6 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEA |
| Predicted Species | Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SPAG6 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-80923 | Applications | Species |
|---|---|---|
| Naro C, Pellegrini L et al. Functional Interaction between U1snRNP and Sam68 Insures Proper 3' End Pre-mRNA Processing during Germ Cell Differentiation. Cell Rep 2019-12-03 [PMID: 30865884] (WB, Mouse) | WB | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Livia Pellegrini |
WB | Mouse | 04/05/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SPAG6 Antibody [NBP1-80923] - Staining in human fallopian tube and colon tissues using anti-SPAG6 antibody. Corresponding SPAG6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SPAG6-Antibody-Immunohistochemistry-Paraffin-NBP1-80923-img0008.jpg "Immunohistochemistry-Paraffin: SPAG6 Antibody [NBP1-80923] - Staining in human fallopian tube and colon tissues using anti-SPAG6 antibody. Corresponding SPAG6 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SPAG6 Antibody [NBP1-80923] - Staining of human colon shows low expression as expected.](http://images.novusbio.com/fullsize/SPAG6-Antibody-Immunohistochemistry-Paraffin-NBP1-80923-img0006.jpg "Immunohistochemistry-Paraffin: SPAG6 Antibody [NBP1-80923] - Staining of human colon shows low expression as expected.")
![Immunohistochemistry-Paraffin: SPAG6 Antibody [NBP1-80923] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize/SPAG6-Antibody-Immunohistochemistry-Paraffin-NBP1-80923-img0007.jpg "Immunohistochemistry-Paraffin: SPAG6 Antibody [NBP1-80923] - Staining of human fallopian tube shows high expression.")
![Immunocytochemistry FoxJ1/HFH4 Antibody [Unconjugated]](https://images.novusbio.com/images2/FoxJ1_AF3619_Immunocytochemistry_15937.jpg)
![Immunocytochemistry FoxJ1/HFH4 Antibody [Unconjugated]](https://images.novusbio.com/images2/FoxJ1_AF3619_Immunocytochemistry_10943.jpg)
![Simple Western FoxJ1/HFH4 Antibody [Unconjugated]](https://images.novusbio.com/images2/FoxJ1_AF3619_Simple_Western_22131.jpg)
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
