COL9A3 Antibody

Images

 
Immunohistochemistry: COL9A3 Antibody [NBP1-85161] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COL9A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL9A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
COL9A3 Protein (NBP1-85161PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COL9A3 Antibody

  • collagen type IX proteoglycan
  • collagen, type IX, alpha 3
  • DJ885L7.4.1
  • EDM3collagen alpha-3(IX) chain
  • FLJ90759
  • IDDcollagen IX, alpha-3 polypeptide
  • MED

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP1-77022
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF6567
Species: Hu, Mu
Applications: WB, IHC
NB100-56149
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30450
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001836-M04
Species: Hu
Applications: WB, ELISA
H00001297-T01
Species: Hu
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-46004
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85161
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for COL9A3 Antibody (NBP1-85161) (0)

There are no publications for COL9A3 Antibody (NBP1-85161).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL9A3 Antibody (NBP1-85161) (0)

There are no reviews for COL9A3 Antibody (NBP1-85161). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for COL9A3 Antibody (NBP1-85161) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COL9A3 Products

Bioinformatics Tool for COL9A3 Antibody (NBP1-85161)

Discover related pathways, diseases and genes to COL9A3 Antibody (NBP1-85161). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL9A3 Antibody (NBP1-85161)

Discover more about diseases related to COL9A3 Antibody (NBP1-85161).
 

Pathways for COL9A3 Antibody (NBP1-85161)

View related products by pathway.

PTMs for COL9A3 Antibody (NBP1-85161)

Learn more about PTMs related to COL9A3 Antibody (NBP1-85161).

Blogs on COL9A3

There are no specific blogs for COL9A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COL9A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL9A3