COL9A1 Antibody - BSA Free

Immunohistochemistry-Paraffin: COL9A1 Antibody [NBP2-68987] - staining of human retina shows strong cytopalsmic positivity in cones.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

COL9A1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL9A1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  COL9A1 Recombinant Protein Antigen (NBP2-68987PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for COL9A1 Antibody - BSA Free

• alpha-1 polypeptide
• collagen, type IX, alpha 1

Background

The COL9A1 gene encodes one of the three alpha chains of type IX collagen, which is a minor (5-20%) collagen component ofhyaline cartilage. Type IX collagen is usually found in tissues containing type II collagen, a fibrillar collagen.Studies in knockout mice h

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL9A1