Collagen IX alpha 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Collagen IX alpha 2 Antibody [NBP2-30450] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & vesicles.
Immunohistochemistry-Paraffin: Collagen IX alpha 2 Antibody [NBP2-30450] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Collagen IX alpha 2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PGKPGRPGTIQGLEGSADFLCPTNCPPGMKGPPGLQGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL9A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Collagen IX alpha 2 Recombinant Protein Antigen (NBP2-30450PEP)
Publications
Read Publication using NBP2-30450.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25852475)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Collagen IX alpha 2 Antibody

  • Alpha 2 Type IX Collagen
  • COL9A2
  • Collagen Alpha-2(IX) Chain
  • Collagen IX, Alpha-2 Polypeptide
  • Collagen, Type IX, Alpha 2
  • DJ39G22.4
  • EDM2
  • MED
  • STL5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP1-77022
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
H00001836-M04
Species: Hu
Applications: WB, ELISA
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46004
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-58159
Species: Hu
Applications: ICC/IF
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Collagen IX alpha 2 Antibody (NBP2-30450)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for Collagen IX alpha 2 Antibody (NBP2-30450) (0)

There are no reviews for Collagen IX alpha 2 Antibody (NBP2-30450). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Collagen IX alpha 2 Antibody (NBP2-30450) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collagen IX alpha 2 Products

Bioinformatics Tool for Collagen IX alpha 2 Antibody (NBP2-30450)

Discover related pathways, diseases and genes to Collagen IX alpha 2 Antibody (NBP2-30450). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen IX alpha 2 Antibody (NBP2-30450)

Discover more about diseases related to Collagen IX alpha 2 Antibody (NBP2-30450).
 

Pathways for Collagen IX alpha 2 Antibody (NBP2-30450)

View related products by pathway.

PTMs for Collagen IX alpha 2 Antibody (NBP2-30450)

Learn more about PTMs related to Collagen IX alpha 2 Antibody (NBP2-30450).

Blogs on Collagen IX alpha 2

There are no specific blogs for Collagen IX alpha 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen IX alpha 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL9A2
Uniprot