CMAS Antibody


Western Blot: CMAS Antibody [NBP1-52910] - Fetal Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CMAS Antibody Summary

Synthetic peptides corresponding to CMAS(cytidine monophosphate N-acetylneuraminic acid synthetase) The peptide sequence was selected from the N terminal of CMAS. Peptide sequence GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CMAS and was validated on Western blot.
Positive Control
CMAS Lysate (NBP2-65881)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CMAS Antibody

  • CMP-N-acetylneuraminic acid synthase
  • CMP-N-acetylneuraminic acid synthetase
  • CMP-Neu5Ac synthetase
  • CMP-NeuNAc synthase
  • CMP-NeuNAc synthetase
  • cytidine 5'-monophosphate N-acetylneuraminic acid synthetase
  • cytidine monophosphate N-acetylneuraminic acid synthetase
  • EC
  • N-acylneuraminate cytidylyltransferase


CMAS is an enzyme that catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus.The enzyme encoded by this gene catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IP (-), WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC

Publications for CMAS Antibody (NBP1-52910) (0)

There are no publications for CMAS Antibody (NBP1-52910).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMAS Antibody (NBP1-52910) (0)

There are no reviews for CMAS Antibody (NBP1-52910). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CMAS Antibody (NBP1-52910) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional CMAS Products

Bioinformatics Tool for CMAS Antibody (NBP1-52910)

Discover related pathways, diseases and genes to CMAS Antibody (NBP1-52910). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CMAS Antibody (NBP1-52910)

Discover more about diseases related to CMAS Antibody (NBP1-52910).

Pathways for CMAS Antibody (NBP1-52910)

View related products by pathway.

PTMs for CMAS Antibody (NBP1-52910)

Learn more about PTMs related to CMAS Antibody (NBP1-52910).

Blogs on CMAS

There are no specific blogs for CMAS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CMAS Antibody and receive a gift card or discount.


Gene Symbol CMAS