Regucalcin Antibody

Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Analysis in human adrenal gland and tonsil tissues using NBP1-80849 antibody. Corresponding RGN RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland, kidney, liver and tonsil using Anti-RGN antibody NBP1-80849 (A) shows similar protein distribution across tissues to independent antibody NBP1-80850 (B).

Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).

Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Western Blot: Regucalcin Antibody [NBP1-80849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500

Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland shows strong positivity in glandular cells.

Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human liver shows strong positivity in hepatocytes.

Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Regucalcin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RGN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Regucalcin Protein (NBP1-80849PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Regucalcin Antibody

• EC 3.1.1.17
• gluconolactonase
• GNL
• RCsenescence marker protein-30
• regucalcin (senescence marker protein-30)
• Senescence marker protein 30
• SMP-30
• SMP30regucalcin

Background

Regucalcin is encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in two transcript variants having different 5' UTRs, but encoding the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Regucalcin Antibody (NBP1-80849)(3)

Publications using NBP1-80849

• Alnafisah R, Lundh A, Asah SM et al. Altered purinergic receptor expression in the frontal cortex in schizophrenia Schizophrenia (Heidelberg, Germany) 2022-11-14 [PMID: 36376358] (WB, Human)
  
  Details:
  Dilution used in WB 1:1000
• Kim JS, Lee HL, Jeong JH et al. OR2AT4, an Ectopic Olfactory Receptor, Suppresses Oxidative Stress-Induced Senescence in Human Keratinocytes Antioxidants (Basel, Switzerland) 2022-11-03 [PMID: 36358552] (ICC/IF, Human)
  
  Details:
  Dilution used in ICC 1:200
• Yang M, Chen Y, Tu S et al. Utilizing an Animal Model to Identify Brain Neurodegeneration-Related Biomarkers in Aging International Journal of Molecular Sciences 2021-03-23 [PMID: 33807010] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: RGN
• Entrez:
  • 9104(Human)