Regucalcin Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Analysis in human adrenal gland and tonsil tissues using NBP1-80849 antibody. Corresponding RGN RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland, kidney, liver and tonsil using Anti-RGN antibody NBP1-80849 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Western Blot: Regucalcin Antibody [NBP1-80849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland shows strong positivity in glandular cells.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human liver shows strong positivity in hepatocytes.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Regucalcin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Regucalcin Protein (NBP1-80849PEP)
Publications
Read Publication using
NBP1-80849 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Regucalcin Antibody

  • EC 3.1.1.17
  • gluconolactonase
  • GNL
  • RCsenescence marker protein-30
  • regucalcin (senescence marker protein-30)
  • Senescence marker protein 30
  • SMP-30
  • SMP30regucalcin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6174
Species: Hu
Applications: IHC, IP, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-68766
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-57578
Species: Hu
Applications: WB
NBP1-87349
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-88036
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
664-LI/CF
Species: Hu
Applications: BA
NBP1-82455
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB7665
Species: Hu
Applications: IHC, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MAB1936
Species: Hu
Applications: IP, WB
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Regucalcin Antibody (NBP1-80849)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Regucalcin Antibody (NBP1-80849) (0)

There are no reviews for Regucalcin Antibody (NBP1-80849). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Regucalcin Antibody (NBP1-80849) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Regucalcin Products

Bioinformatics Tool for Regucalcin Antibody (NBP1-80849)

Discover related pathways, diseases and genes to Regucalcin Antibody (NBP1-80849). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Regucalcin Antibody (NBP1-80849)

Discover more about diseases related to Regucalcin Antibody (NBP1-80849).
 

Pathways for Regucalcin Antibody (NBP1-80849)

View related products by pathway.

PTMs for Regucalcin Antibody (NBP1-80849)

Learn more about PTMs related to Regucalcin Antibody (NBP1-80849).
 

Research Areas for Regucalcin Antibody (NBP1-80849)

Find related products by research area.

Blogs on Regucalcin

There are no specific blogs for Regucalcin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Regucalcin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGN
Entrez