![Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).](http://images.novusbio.com/fullsize2/Regucalcin-Antibody-Western-Blot-NBP1-80849-img0019.jpg "Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSY |
| Specificity | Specificity of human, mouse, rat Regucalcin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RGN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for Regucalcin Antibody (NBP1-80849)Discover more about diseases related to Regucalcin Antibody (NBP1-80849).
| Pathways for Regucalcin Antibody (NBP1-80849)View related products by pathway.
|
PTMs for Regucalcin Antibody (NBP1-80849)Learn more about PTMs related to Regucalcin Antibody (NBP1-80849).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney.](http://images.novusbio.com/fullsize2/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0022.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney.")
![Western Blot: Regucalcin Antibody [NBP1-80849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500](http://images.novusbio.com/fullsize2/Regucalcin-Antibody-Western-Blot-NBP1-80849-img0004.jpg "Western Blot: Regucalcin Antibody [NBP1-80849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500")
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland shows high expression.](http://images.novusbio.com/fullsize2/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0014.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland shows high expression.")
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize2/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0015.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human cerebral cortex shows low expression as expected.")
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining in human adrenal gland and cerebral cortex tissues using anti-RGN antibody. Corresponding RGN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0017.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining in human adrenal gland and cerebral cortex tissues using anti-RGN antibody. Corresponding RGN RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland, kidney, liver and testis using Anti-RGN antibody NBP1-80849 (A) shows similar protein distribution across tissues to independent antibody NBP1-80850 (B).](http://images.novusbio.com/fullsize2/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0018.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland, kidney, liver and testis using Anti-RGN antibody NBP1-80849 (A) shows similar protein distribution across tissues to independent antibody NBP1-80850 (B).")
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human liver.](http://images.novusbio.com/fullsize2/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0020.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human liver.")
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human testis.](http://images.novusbio.com/fullsize2/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0021.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human testis.")
![Western Blot: RB1 Antibody [NB100-56888] - Analysis of Retinoblastoma 1 in 30 ugs of Jurkat cell lysate using NB100-56888 at 1:1000 dilution.](http://images.novusbio.com/fullsize2/RB1-Antibody-Western-Blot-NB100-56888-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: DYX1C1 Antibody [NBP2-47476] - Staining of human cell line HeLa shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/DYX1C1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47476-img0003.jpg)
![Immunohistochemistry-Paraffin: DYX1C1 Antibody [NBP2-47476] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.](http://images.novusbio.com/fullsize2/DYX1C1-Antibody-Immunohistochemistry-NBP2-47476-img0002.jpg)
![Western Blot: PEX7 Antibody [NBP1-57578] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/PEX7-Antibody-Western-Blot-NBP1-57578-img0002.jpg)
![Western Blot: PHYH Antibody [NBP1-87349] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue](http://images.novusbio.com/fullsize2/PHYH-Antibody-Western-Blot-NBP1-87349-img0005.jpg)
![Immunohistochemistry-Paraffin: PHYH Antibody [NBP1-87349] - Staining of human liver shows cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/PHYH-Antibody-Immunohistochemistry-Paraffin-NBP1-87349-img0001.jpg)
![Western Blot: PHYH Antibody [NBP1-87349] - Analysis using Anti-PHYH antibody NBP1-87349 (A) shows similar pattern to independent antibody NBP1-87348 (B).](http://images.novusbio.com/fullsize2/PHYH Antibody-Western Blot-NBP1-87349-img0006.jpg)
![Western Blot: NELF-E Antibody [NBP1-88036] - Analysis using Anti-NELFE antibody NBP1-88036 (A) shows similar pattern to independent antibody NBP2-55487 (B).](http://images.novusbio.com/fullsize2/NELF-E-Antibody-Western-Blot-NBP1-88036-img0014.jpg)
![Immunohistochemistry-Paraffin: NELF-E Antibody [NBP1-88036] - Staining in human testis and skeletal muscle tissues. Corresponding NELFE RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/NELF-E-Antibody-Immunohistochemistry-Paraffin-NBP1-88036-img0013.jpg)
![Western Blot: NELF-E Antibody [NBP1-88036] - Analysis in human cell line MOLT-4.](http://images.novusbio.com/fullsize2/NELF-E-Antibody-Western-Blot-NBP1-88036-img0007.jpg)
![Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human Jurkat, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.](http://images.novusbio.com/fullsize2/Calmodulin-3-Antibody-Western-Blot-NBP1-98474-img0005.jpg)
![Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Titration: 1.0 ug/ml Positive Control: Hela Whole Cell.](http://images.novusbio.com/fullsize2/Calmodulin-3-Antibody-Western-Blot-NBP1-98474-img0002.jpg)
![Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human 721_B, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.](http://images.novusbio.com/fullsize2/Calmodulin-3-Antibody-Western-Blot-NBP1-98474-img0003.jpg)
![Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Sample (50 ug of whole cell lysate) A: Mouse brain 15% SDS PAGE; antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/Calmodulin 2 Antibody-Western Blot-NBP2-14871-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.](http://images.novusbio.com/fullsize2/Calmodulin-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14871-img0003.jpg)
![Western Blot: Calmodulin Antibody (2D1) [NB120-2860] - Purified Calmodulin using NB120-2860 and NB120-5494.](http://images.novusbio.com/fullsize2/Calmodulin-Antibody-(2D1)-Western-Blot-NB120-2860-img0028.jpg)
![Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Staining of rat brain.](http://images.novusbio.com/fullsize2/Calmodulin-Antibody-(2D1)-Immunocytochemistry-Immunofluorescence-NB120-2860-img0008.jpg)
![Immunohistochemistry-Paraffin: Calmodulin Antibody (2D1) [NB120-2860] - Normal biopsies of deparaffinized Rat testis tissue.](http://images.novusbio.com/fullsize2/Calmodulin-Antibody-(2D1)-Immunohistochemistry-Paraffin-NB120-2860-img0013.jpg)
![Western Blot: p130 Antibody [NBP1-82455] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/p130-Antibody-Western-Blot-NBP1-82455-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: p130 Antibody [NBP1-82455] - Staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/p130-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82455-img0011.jpg)
![Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human kidney shows nuclear positivity both in tubules and in glomeruli.](http://images.novusbio.com/fullsize2/p130-Antibody-Immunohistochemistry-Paraffin-NBP1-82455-img0007.jpg)
![Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis using Anti-PLOD1 antibody NBP2-38770 (A) shows similar pattern to independent antibody NBP2-31885 (B).](http://images.novusbio.com/fullsize2/PLOD1 Antibody-Western Blot-NBP2-38770-img0004.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.](http://images.novusbio.com/fullsize2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0004.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)](http://images.novusbio.com/fullsize2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0002.jpg)
![Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Analysis using the biotin conjugate of NB100-56503. Detection of Cytochrome C in 15 mg of HeLa cell lysate using NB100-55775 at 1:1000. A 15 kDa band is detected.](http://images.novusbio.com/fullsize2/Cytochrome-c-Antibody-(7H8.2C12)-Western-Blot-NB100-56503-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - p73 was detected in immersion fixed Hela human cell line using NB100-56503 at 25 ug/ml for 3 hours at room temperature. Cells were stained using the NorthernLights(TM) 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and mitochondria.](http://images.novusbio.com/fullsize2/Cytochrome-c-Antibody-(7H8.2C12)-Immunocytochemistry-Immunofluorescence-NB100-56503-img0010.jpg)
![Immunohistochemistry-Paraffin: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Cytochrome C was detected in immersion fixed paraffin-embedded sections of human heart using anti-human mouse monoclonal antibody (Catalog # NB100-56503) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/fullsize2/Cytochrome-c-Antibody-(7H8.2C12)-Immunohistochemistry-Paraffin-NB100-56503-img0004.jpg)
![Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.](http://images.novusbio.com/fullsize2/Albumin-Antibody-Western-Blot-NB600-41532-img0002.jpg)
-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")