Regucalcin Antibody

Images

 
Independent Antibodies: Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney.
Western Blot: Regucalcin Antibody [NBP1-80849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human cerebral cortex shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining in human adrenal gland and cerebral cortex tissues using anti-RGN antibody. Corresponding RGN RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland, kidney, liver and testis using Anti-RGN antibody NBP1-80849 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human liver.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human testis.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Regucalcin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSY
Specificity
Specificity of human, mouse, rat Regucalcin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Regucalcin Antibody

  • EC 3.1.1.17
  • gluconolactonase
  • GNL
  • RCsenescence marker protein-30
  • regucalcin (senescence marker protein-30)
  • Senescence marker protein 30
  • SMP-30
  • SMP30regucalcin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6174
Species: Hu
Applications: WB, IHC, IP
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
MAB49281
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu, Mu, Rt, Bv, Ca, GP, Rb, Ze
Applications: WB
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu, Rt, Po
Applications: WB
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-65676
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Regucalcin Antibody (NBP1-80849) (0)

There are no publications for Regucalcin Antibody (NBP1-80849).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Regucalcin Antibody (NBP1-80849) (0)

There are no reviews for Regucalcin Antibody (NBP1-80849). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Regucalcin Antibody (NBP1-80849) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Regucalcin Products

Bioinformatics Tool for Regucalcin Antibody (NBP1-80849)

Discover related pathways, diseases and genes to Regucalcin Antibody (NBP1-80849). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Regucalcin Antibody (NBP1-80849)

Discover more about diseases related to Regucalcin Antibody (NBP1-80849).
 

Pathways for Regucalcin Antibody (NBP1-80849)

View related products by pathway.

PTMs for Regucalcin Antibody (NBP1-80849)

Learn more about PTMs related to Regucalcin Antibody (NBP1-80849).

Blogs on Regucalcin

There are no specific blogs for Regucalcin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Regucalcin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGN
Entrez