Home » Regucalcin » Regucalcin Antibodies » Regucalcin Antibody

Regucalcin Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).
Independent Antibodies: Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Western Blot: Regucalcin Antibody [NBP1-80849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human liver.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human testis.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland, kidney, liver and tonsil using Anti-RGN antibody NBP1-80849 (A) shows similar protein distribution across tissues to ...read more
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Analysis in human adrenal gland and tonsil tissues using NBP1-80849 antibody. Corresponding RGN RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland shows strong positivity in glandular cells.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human liver shows strong positivity in hepatocytes.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

        

Order Details

100% Guarantee on every product

Regucalcin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSY
Specificity
Specificity of human Regucalcin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Regucalcin Protein (NBP1-80849PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Regucalcin Antibody

  • EC 3.1.1.17
  • gluconolactonase
  • GNL
  • RCsenescence marker protein-30
  • regucalcin (senescence marker protein-30)
  • Senescence marker protein 30
  • SMP-30
  • SMP30regucalcin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cytosolic
Sulfotransferase 2B1/ ...
AF6174
Western blot shows lysates of human prostate cancer tissue. PVDF Membrane was probed with 1 µg/mL of Human Cytosolic Sulfotransferase 2B1/SULT2B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6174) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Cytosolic Sulfotransferase 2B1/SULT2B1 at approximately 48 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Cytosolic Sulfotransferase 2B1/SULT2B1 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using Human Cytosolic Sulfotransferase 2B1/SULT2B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6174) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm of glandular epithelial and stromal cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC, IP
RB1 Antibody
NB100-56888
Western Blot: RB1 Antibody [NB100-56888] - Analysis of Retinoblastoma 1 in 30 ugs of Jurkat cell lysate using NB100-56888 at 1:1000 dilution.
(2 Reviews)
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
ERMAP Antibody
AF4928
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human ERMAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4928, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: WB, Flow, CyTOF-ready
DYX1C1 Antibody
NBP1-68766
Western Blot: DYX1C1 Antibody [NBP1-68766] - Staining (0.1ug/ml) of COS1 cell lysates: untransfected (left lane) and transfected with full length recombinant Human DYX1C1 (right lane).
Immunohistochemistry-Paraffin: DYX1C1 Antibody [NBP1-68766] - Staining of paraffin embedded Human Cerebral Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
PEX7 Antibody
NBP1-57578
Western Blot: PEX7 Antibody [NBP1-57578] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
(1 Publication)
Species: Hu
Applications: WB
PHYH Antibody
NBP1-87349
Western Blot: PHYH Antibody [NBP1-87349] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunohistochemistry-Paraffin: PHYH Antibody [NBP1-87349] - Staining of human liver shows cytoplasmic positivity in hepatocytes.
Western Blot: PHYH Antibody [NBP1-87349] - Analysis using Anti-PHYH antibody NBP1-87349 (A) shows similar pattern to independent antibody NBP1-87348 (B).
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NELF-E Antibody
NBP1-88036
Western Blot: NELF-E Antibody [NBP1-88036] - Analysis using Anti-NELFE antibody NBP1-88036 (A) shows similar pattern to independent antibody NBP2-55487 (B).
Immunohistochemistry-Paraffin: NELF-E Antibody [NBP1-88036] - Staining in human testis and skeletal muscle tissues. Corresponding NELFE RNA-seq data are presented for the same tissues.
Western Blot: NELF-E Antibody [NBP1-88036] - Analysis in human cell line MOLT-4.
Species: Hu
Applications: WB, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC
Calmodulin 2
Antibody
NBP2-14871
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Sample (50 ug of whole cell lysate) A: Mouse brain 15% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Calmodulin
Antibody (2D1)
NB120-2860
Western Blot: Calmodulin Antibody (2D1) [NB120-2860] - Purified Calmodulin using NB120-2860 and NB120-5494.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Staining of rat brain.
Immunohistochemistry-Paraffin: Calmodulin Antibody (2D1) [NB120-2860] - Normal biopsies of deparaffinized Rat testis tissue.
(1 Publication)
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(16 Publications)
Species: Hu
p130 Antibody
NBP1-82455
Western Blot: p130 Antibody [NBP1-82455] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: p130 Antibody [NBP1-82455] - Staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human tonsil shows strong nuclear positivity in lymphoid cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY licence.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
(2 Publications)
Species: Hu, Mu
Applications: WB
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Human PTH ELISA
Kit (Colorimetric)
NBP2-60629
ELISA: Human PTH ELISA Kit (Colorimetric) [NBP2-60629]
(1 Publication)
Species: Hu
Cytochrome c
Antibody (7H8.2C12)
NB100-56503
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Analysis using the biotin conjugate of NB100-56503. Detection of Cytochrome C in 15 ug of HeLa cell lysate using NB100-55775 at 1:1000. A 15 kDa band is detected.
Immunocytochemistry/Immunofluorescence: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - p73 was detected in immersion fixed Hela human cell line using NB100-56503 at 25 ug/ml for 3 hours at room temperature. Cells were stained using the NorthernLights(TM) 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Cytochrome C was detected in immersion fixed paraffin-embedded sections of human heart using anti-human mouse monoclonal antibody (Catalog # NB100-56503) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(52 Publications)
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(39 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Human Complement
Component C2 ELISA Ki ...
NBP2-60548
ELISA: Human Complement Component C2 ELISA Kit (Colorimetric) [NBP2-60548] - Standard curve.
Species: Hu
Regucalcin Antibody
NBP1-80849
Regucalcin Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Regucalcin Antibody (NBP1-80849) (0)

There are no publications for Regucalcin Antibody (NBP1-80849).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Regucalcin Antibody (NBP1-80849) (0)

There are no reviews for Regucalcin Antibody (NBP1-80849). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Regucalcin Antibody (NBP1-80849) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Regucalcin Products

Bioinformatics Tool for Regucalcin Antibody (NBP1-80849)

Discover related pathways, diseases and genes to Regucalcin Antibody (NBP1-80849). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Regucalcin Antibody (NBP1-80849)

Discover more about diseases related to Regucalcin Antibody (NBP1-80849).
 

Pathways for Regucalcin Antibody (NBP1-80849)

View related products by pathway.

PTMs for Regucalcin Antibody (NBP1-80849)

Learn more about PTMs related to Regucalcin Antibody (NBP1-80849).

Blogs on Regucalcin

There are no specific blogs for Regucalcin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Regucalcin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RGN
Entrez