![Western Blot: CLYBL Antibody [H00171425-B01P] - Analysis of CLYBL expression in human liver.](http://images.novusbio.com/fullsize/CLYBL-Antibody-Western-Blot-H00171425-B01P-img0003.jpg "Western Blot: CLYBL Antibody [H00171425-B01P] - Analysis of CLYBL expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | CLYBL (AAH34360.1, 1 a.a. - 340 a.a.) full-length human protein. MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK |
| Specificity | Reacts with citrate lyase beta like. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CLYBL |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
| Publication using H00171425-B01P | Applications | Species |
|---|---|---|
| Strittmatter L, Li Y, Nakatsuka NJ et al. CLYBL is a polymorphic human enzyme with malate synthase and beta-methylmalate synthase activity. Hum Mol Genet. 2014-05-01 [PMID: 24334609] (Human) | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CLYBL |
| Entrez |
|
| Uniprot |
|
![Western Blot: CLYBL Antibody [H00171425-B01P] - Analysis of CLYBL expression in transfected 293T cell line by CLYBL polyclonal antibody. Lane 1: CLYBL transfected lysate(37.4 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/CLYBL-Antibody-Western-Blot-H00171425-B01P-img0004.jpg "Western Blot: CLYBL Antibody [H00171425-B01P] - Analysis of CLYBL expression in transfected 293T cell line by CLYBL polyclonal antibody. Lane 1: CLYBL transfected lysate(37.4 KDa). Lane 2: Non-transfected lysate.")
![Western Blot Fc gamma RIII (CD16) Antibody [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIII_AF1597_Western_Blot_23213.jpg)
![SDS-PAGE Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIIIA_4325-FC_411.jpg)
![Binding Activity Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIIIA_4325-FC_491.jpg)
![SEC-MALS Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images/4325-fc_recombinant-human-fc-gamma-riiia-cd16a-protein-cf-sec-mals-2842023172947.jpg)
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_6181.jpg)
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_23533.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")