CDC5L Antibody - BSA Free

Immunohistochemistry-Paraffin: CDC5L Antibody [NBP1-85720] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: CDC5L Antibody [NBP1-85720] - Staining of human cerebral cortex shows strong nuclear positivity in neurons and glial cells.

Immunohistochemistry-Paraffin: CDC5L Antibody [NBP1-85720] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: CDC5L Antibody [NBP1-85720] - Staining of human rectum shows moderate to strong nuclear positivity in glandular cells.

Staining of human cell line U-2 OS shows localization to nucleoplasm.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CDC5L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CDC5L Antibody - BSA Free (NBP1-85720) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILR
• Predicted Species: Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDC5L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CDC5L Protein (NBP1-85720PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CDC5L Antibody - BSA Free

• CDC5 (cell division cycle 5, S. pombe, homolog)-like
• CDC5 cell division cycle 5-like (S. pombe)
• CDC5
• Cdc5-like protein
• Cdc5-related protein
• CEF1
• cell division cycle 5-like protein
• dJ319D22.1 (CDC5-like protein)
• dJ319D22.1
• hCDC5
• KIAA0432
• PCDC5RPCDC5-LIKE
• Pombe cdc5-related protein

Background

CDC5L is encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDC5L