SWI5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SWI5 Antibody [NBP2-30951] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SWI5 Antibody [NBP2-30951] - Staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SWI5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HLDIQKLKEKRDMLDKEISQFVSEGYSVDELEDHITQLHEYNDIKDVGQMLMGKLAVIRGVTTKELYPEFGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SWI5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SWI5 Protein (NBP2-30951PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SWI5 Antibody

  • bA395P17.9
  • C9orf119
  • Chromosome 9 Open Reading Frame 119
  • DNA Repair Protein SWI5 Homolog
  • HBV DNAPTP1-Transactivated Protein A
  • Protein SAE3 Homolog
  • SAE3
  • SWI5 Recombination Repair Homolog (Yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-181
Species: Hu, Mu
Applications: WB, IP
NBP1-90797
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007702-M01
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC-P
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93290
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF2567
Species: Mu
Applications: WB, IHC
NBP2-58116
Species: Hu
Applications: ICC/IF
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30951
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SWI5 Antibody (NBP2-30951) (0)

There are no publications for SWI5 Antibody (NBP2-30951).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SWI5 Antibody (NBP2-30951) (0)

There are no reviews for SWI5 Antibody (NBP2-30951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SWI5 Antibody (NBP2-30951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SWI5 Products

SWI5 NBP2-30951

Bioinformatics Tool for SWI5 Antibody (NBP2-30951)

Discover related pathways, diseases and genes to SWI5 Antibody (NBP2-30951). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SWI5 Antibody (NBP2-30951)

Discover more about diseases related to SWI5 Antibody (NBP2-30951).
 

Pathways for SWI5 Antibody (NBP2-30951)

View related products by pathway.

PTMs for SWI5 Antibody (NBP2-30951)

Learn more about PTMs related to SWI5 Antibody (NBP2-30951).

Blogs on SWI5

There are no specific blogs for SWI5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SWI5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SWI5
Uniprot