![Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Analysis in human esophagus and placenta tissues. Corresponding Chymase/CMA1/Mast Cell Chymase RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Chymase-CMA1-Mast-Cell-Chymase-Antibody-Immunohistochemistry-Paraffin-NBP2-33660-img0007.jpg "Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Analysis in human esophagus and placenta tissues. Corresponding Chymase/CMA1/Mast Cell Chymase RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Chymase/CMA1/Mast Cell Chymase Antibody - BSA Free (NBP2-33660) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Chymase/CMA1/Mast Cell Chymase Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CMA1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
| Publication using NBP2-33660 | Applications | Species |
|---|---|---|
| McLeod DS, Bhutto I, Edwards MM et al. Mast Cell-Derived Tryptase in Geographic Atrophy Invest. Ophthalmol. Vis. Sci. 2017-11-01 [PMID: 29164232] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Chymase/CMA1/Mast Cell Chymase Antibody (NBP2-33660)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Aged control whole mount choroid immunolabeled for (A) UEA lectin (blue), (B) tryptase (red), and (C) chymase (green). The vast majority of human choroidal MCs are of the MCT phenotype (tryptase+/chymase-). Only a small percentage of MCs are MCtc (tryptase+/chymase+) (arrows). Scale bar: 30 um. Image collected and cropped by CiteAb from the following publication (//iovs.arvojournals.org/article.aspx?doi=10.1167/iovs.17-22989), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Chymase-CMA1-Mast-Cell-Chymase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33660-img0013.jpg "Immunocytochemistry/Immunofluorescence: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Aged control whole mount choroid immunolabeled for (A) UEA lectin (blue), (B) tryptase (red), and (C) chymase (green). The vast majority of human choroidal MCs are of the MCT phenotype (tryptase+/chymase-). Only a small percentage of MCs are MCtc (tryptase+/chymase+) (arrows). Scale bar: 30 um. Image collected and cropped by CiteAb from the following publication (//iovs.arvojournals.org/article.aspx?doi=10.1167/iovs.17-22989), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/Chymase-CMA1-Mast-Cell-Chymase-Antibody-Immunohistochemistry-Paraffin-NBP2-33660-img0012.jpg "Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
![Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/Chymase-CMA1-Mast-Cell-Chymase-Antibody-Immunohistochemistry-Paraffin-NBP2-33660-img0008.jpg "Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Staining of human colon shows strong cytoplasmic positivity in mast cell.](http://images.novusbio.com/fullsize/Chymase-CMA1-Mast-Cell-Chymase-Antibody-Immunohistochemistry-Paraffin-NBP2-33660-img0009.jpg "Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Staining of human colon shows strong cytoplasmic positivity in mast cell.")
![Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Staining of human esophagus shows strong cytoplasmic positivity in mast cell.](http://images.novusbio.com/fullsize/Chymase-CMA1-Mast-Cell-Chymase-Antibody-Immunohistochemistry-Paraffin-NBP2-33660-img0010.jpg "Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Staining of human esophagus shows strong cytoplasmic positivity in mast cell.")
![Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Staining of human lymph node shows strong cytoplasmic positivity in mast cell.](http://images.novusbio.com/fullsize/Chymase-CMA1-Mast-Cell-Chymase-Antibody-Immunohistochemistry-Paraffin-NBP2-33660-img0011.jpg "Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Staining of human lymph node shows strong cytoplasmic positivity in mast cell.")
![Immunocytochemistry/ Immunofluorescence: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Aged control whole mount choroid immunolabeled for (A) UEA lectin (blue), (B) tryptase (red), & (C) chymase (green). The vast majority of human choroidal MCs are of the MCT phenotype (tryptase+/chymase−). Only a small percentage of MCs are MCtc (tryptase+/chymase+) (arrows). Scale bar: 30 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29164232), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33660_rabbit-polyclonal-chymase-cma1-mast-cell-chymase-antibody-310202415291960.jpg "Immunocytochemistry/ Immunofluorescence: Chymase/CMA1/Mast Cell Chymase Antibody [NBP2-33660] - Aged control whole mount choroid immunolabeled for (A) UEA lectin (blue), (B) tryptase (red), & (C) chymase (green). The vast majority of human choroidal MCs are of the MCT phenotype (tryptase+/chymase−). Only a small percentage of MCs are MCtc (tryptase+/chymase+) (arrows). Scale bar: 30 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29164232), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Western Blot EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Western_Blot_16707.jpg)
![Immunohistochemistry EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Immunohistochemistry_17212.jpg)
![Knockout Validated EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Knockout_Validated_22526.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")